Property Summary

NCBI Gene PubMed Count 65
PubMed Score 152.44
PubTator Score 72.66

Knowledge Summary

Patent

No data available

Expression

Gene RIF (35)

PMID Text
26606907 Data suggest 5S ribosomal RNA is a direct target of miR-150 and miR-383 in esophageal squamous cell carcinoma (ESCC); overexpression of miR-150 and miR-383 inhibits ESCC cell proliferation in vitro and in vivo and intensifies RPL11/c-Myc interaction.
26362536 HIV-1 Gag interacts with RPL11 as demonstrated by proximity dependent biotinylation proteomics
25829192 Data indicate that ribosomal protein L11 (RPL11)-expressing cells proliferated more rapidly than the ribosomal protein L11 (RPL11)-expressing cells.
25544755 Data indicate that ribosomal protein (L11) promotes the recruitment of microRNA-130a (miR-130a) to oncoprotein c-Myc in response to UV irradiation treatment.
25301064 Ribosomal proteins L11 and L5 activate TAp73 by overcoming MDM2 inhibition.
24463277 levels of branched-chain aminotransferase-1 (BCAT1) transcripts are significantly decreased on the polysomes of both RPS19 and RPL11 cells and that translation of BCAT1 protein is especially impaired in cells with small RP gene mutations
24141778 Findings uncover a mechanism by which RPL5 and RPL11 can co-operatively suppress c-Myc expression, allowing a tightly controlled ribosome biogenesis in cells.
24061479 Unlike other tumor suppressors, RPL5 and RPL11 play essential roles in normal cell proliferation.
24045667 Findings suggest that PICT1 has a crucial role in gastric cancer progression by regulating the MDM2-TP53 pathway through RPL11.
23874603 HIV-1 Gag interacts with RPL11 as demonstrated by proximity dependent biotinylation proteomics
23169665 disrupted nucleoli may provide a platform for L5- and L11-dependent p53 activation, implying a role for the nucleolus in p53 activation by ribosomal biogenesis stress
22833095 RPL11 mutations led to a dramatic decrease in progenitor cell proliferation and a delayed erythroid differentiation with a marked increase in apoptosis and G0/1 cell cycle arrest with activation of p53.
22467867 ARF activates p53, at least partly by induction of ribosomal stress, which results in L11 suppression of MDM2
22081073 The studies provide insights on how nucleolar stress through L11 and NEDD8 can activate the transcriptional activity of p53.
21903592 Hydrophilic residues are crucial for ribosomal protein L11 (RPL11) interaction with zinc finger domain of MDM2 and p53 protein activation
21807902 Results identify a novel regulatory paradigm wherein L11 plays a critical role in controlling c-myc mRNA turnover via recruiting miR-24/miRISC in response to ribosomal stress.
20935493 Data report that depletion of L37 leads to cell cycle arrest in a MDM2/L11- and p53-dependent manner.
20554519 Knockdown of L29 or L30 enhanced the interaction of MDM2 with L11 and L5 and markedly inhibited MDM2-mediated p53 ubiquitination, suggesting that direct perturbation of 60 S ribosomal biogenesis activates p53 via L11- and L5-mediated MDM2 suppression.
20378560 Observational study of gene-disease association. (HuGE Navigator)
20194507 L11 suppresses c-Myc-dependent and RNA polymerase III-catalyzed transcription of 5 S rRNA and tRNA genes in response to ribosomal stress, ensuring a tight coordination between c-Myc activity and ribosomal biogenesis.
20056613 cells survey the maturation of the small and large ribosomal subunits by separate molecular routes, which may merge in an L11-dependent signaling pathway for p53 stabilization.
19773262 The study reports a high frequency of RPL5 (9.3%) and RPL11 (9.3%) mutations in a Diamond-Blackfan anemia cohort.
19773262 Observational study of gene-disease association. (HuGE Navigator)
19713960 identify NEDD8 as a crucial regulator of L11 RP signalling to p53. A decrease in L11 NEDDylation during nucleolar stress causes relocalization of L11 from the nucleolus to the nucleoplasm.
19287375 The cell selectively upregulates the translation of mRNAs with a polypyrimidine tract at their 5'-transcriptional start site (5'-TOP mRNAs), including that encoding rpL11, on impairment of 40S ribosome biogenesis.
19191325 Mutations in RPL11 were identified in two patients from 2 out of 28 families (7.1%).
19061985 RPL11 mutations are associated with abnormal thumbs in Diamond-Blackfan anemia patients.
18560357 L11 cooperates with L5, resulting in a robust inhibition of the E3 activity of MDM2, and a stabilization and activation of p53 approaching that achieved by p14(ARF).
18389627 Transcription factor YY1 participates in activation transcription of the human ribosomal protein L11 gene
17599065 These results identify L11 as a feedback inhibitor of c-Myc and suggest a novel role for L11 in regulating c-Myc-enhanced ribosomal biogenesis.
17116689 Cancer-associated missense mutations targeting MDM2's central zinc finger disrupt the interaction of MDM2 with L5 and L11.
16803902 differentially regulates the levels of ubiquitinated p53 and MDM2 and inhibits the turnover and activity of MDM2 through a post-ubiquitination mechanism
15308643 the MDM2-L5-L11-L23 complex functions to inhibit MDM2-mediated p53 ubiquitination and thus activates p53
15152193 L11 is not regulated by transcription or protein stability and its level remains relatively constant during serum starvation, which induces translocation of L11 from the nucleolus to the nucleoplasm, where it participates in a complex with HDM2
14612427 L11 functions as a negative regulator of HDM2 and there might exist in vivo an L11-HDM2-p53 pathway for monitoring ribosomal integrity

AA Sequence

MAQDQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKIAV      1 - 70
HCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGFS     71 - 140
IADKKRRTGCIGAKHRISKEEAMRWFQQKYDGIILPGK                                    141 - 178
//

Text Mined References (73)

PMID Year Title
26606907 2015 Down-regulation of 5S rRNA by miR-150 and miR-383 enhances c-Myc-rpL11 interaction and inhibits proliferation of esophageal squamous carcinoma cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25829192 2015 Ribosomal protein L11- and retinol dehydrogenase 11-induced erythroid proliferation without erythropoietin in UT-7/Epo erythroleukemic cells.
25544755 2015 MicroRNA-130a associates with ribosomal protein L11 to suppress c-Myc expression in response to UV irradiation.
25416956 2014 A proteome-scale map of the human interactome network.
25301064 2015 Ribosomal proteins L11 and L5 activate TAp73 by overcoming MDM2 inhibition.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24463277 2014 Translation of branched-chain aminotransferase-1 transcripts is impaired in cells haploinsufficient for ribosomal protein genes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24141778 2014 Ribosomal proteins L5 and L11 co-operatively inactivate c-Myc via RNA-induced silencing complex.
24061479 2013 Loss of tumor suppressor RPL5/RPL11 does not induce cell cycle arrest but impedes proliferation due to reduced ribosome content and translation capacity.
24045667 2013 PICT1 regulates TP53 via RPL11 and is involved in gastric cancer progression.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23776465 2013 Myeloma overexpressed 2 (Myeov2) regulates L11 subnuclear localization through Nedd8 modification.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23507139 2013 The HBx protein of hepatitis B virus confers resistance against nucleolar stress and anti-cancer drug-induced p53 expression.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23169665 2012 Mutual protection of ribosomal proteins L5 and L11 from degradation is essential for p53 activation upon ribosomal biogenesis stress.
22833095 2012 Primary hematopoietic cells from DBA patients with mutations in RPL11 and RPS19 genes exhibit distinct erythroid phenotype in vitro.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22467867 2012 Physical and functional interaction between ribosomal protein L11 and the tumor suppressor ARF.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22081073 2012 Recruitment of RPL11 at promoter sites of p53-regulated genes upon nucleolar stress through NEDD8 and in an Mdm2-dependent manner.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21903592 2011 Hydrophilic residues are crucial for ribosomal protein L11 (RPL11) interaction with zinc finger domain of MDM2 and p53 protein activation.
21807902 2011 Ribosomal protein L11 recruits miR-24/miRISC to repress c-Myc expression in response to ribosomal stress.
21399665 2011 The balance between rRNA and ribosomal protein synthesis up- and downregulates the tumour suppressor p53 in mammalian cells.
21269460 2011 Initial characterization of the human central proteome.
20935493 2010 Depletion of ribosomal protein L37 occurs in response to DNA damage and activates p53 through the L11/MDM2 pathway.
20554519 2010 Perturbation of 60 S ribosomal biogenesis results in ribosomal protein L5- and L11-dependent p53 activation.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20378560 2010 Mutations in the ribosomal protein genes in Japanese patients with Diamond-Blackfan anemia.
20194507 2010 Ribosomal protein L11 associates with c-Myc at 5 S rRNA and tRNA genes and regulates their expression.
20056613 2010 Defects in 18 S or 28 S rRNA processing activate the p53 pathway.
19946888 2010 Defining the membrane proteome of NK cells.
19773262 2010 Diamond-Blackfan anemia: genotype-phenotype correlations in Italian patients with RPL5 and RPL11 mutations.
19713960 2009 Regulation of nucleolar signalling to p53 through NEDDylation of L11.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19417104 2009 SMG-8 and SMG-9, two novel subunits of the SMG-1 complex, regulate remodeling of the mRNA surveillance complex during nonsense-mediated mRNA decay.
19287375 2009 Absence of nucleolar disruption after impairment of 40S ribosome biogenesis reveals an rpL11-translation-dependent mechanism of p53 induction.
19191325 2009 Identification of mutations in the ribosomal protein L5 (RPL5) and ribosomal protein L11 (RPL11) genes in Czech patients with Diamond-Blackfan anemia.
19061985 2008 Ribosomal protein L5 and L11 mutations are associated with cleft palate and abnormal thumbs in Diamond-Blackfan anemia patients.
18697920 2008 The role of human ribosomal proteins in the maturation of rRNA and ribosome production.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18560357 2008 Cooperation between the ribosomal proteins L5 and L11 in the p53 pathway.
18389627 [Transcription factor YY1 participates in activation transcription of the human ribosomal protein L11 gene].
18274552 2008 Ribosomal proteins are targets for the NEDD8 pathway.
17599065 2007 Inhibition of c-Myc activity by ribosomal protein L11.
17373842 2007 HDM2-binding partners: interaction with translation elongation factor EF1alpha.
17310983 2007 Ribosomal protein S7 as a novel modulator of p53-MDM2 interaction: binding to MDM2, stabilization of p53 protein, and activation of p53 function.
17116689 2007 Cancer-associated mutations in the MDM2 zinc finger domain disrupt ribosomal protein interaction and attenuate MDM2-induced p53 degradation.
17110929 2006 MDMX regulation of p53 response to ribosomal stress.
16803902 2006 Regulation of the MDM2-p53 pathway by ribosomal protein L11 involves a post-ubiquitination mechanism.
16791210 2006 Dynamic proteomics in individual human cells uncovers widespread cell-cycle dependence of nuclear proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15308643 2004 Inhibition of MDM2-mediated p53 ubiquitination and degradation by ribosomal protein L5.
15195100 2004 PML regulates p53 stability by sequestering Mdm2 to the nucleolus.
15189156 2004 The molecular mechanics of eukaryotic translation.
15152193 2004 Essential role of ribosomal protein L11 in mediating growth inhibition-induced p53 activation.
14612427 2003 Ribosomal protein L11 negatively regulates oncoprotein MDM2 and mediates a p53-dependent ribosomal-stress checkpoint pathway.
14567916 2003 Regulated release of L13a from the 60S ribosomal subunit as a mechanism of transcript-specific translational control.
12962325 2003 Characterization and analysis of posttranslational modifications of the human large cytoplasmic ribosomal subunit proteins by mass spectrometry and Edman sequencing.
12815950 [Structural and functional analysis of the human ribosomal protein L11 gene].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11790298 2002 Directed proteomic analysis of the human nucleolus.
10353821 1999 Human bleomycin hydrolase binds ribosomal proteins.
10343117 1999 Assignment of the L11 ribosomal protein gene (RPL11) to human chromosome 1p36.1-->p35 by in situ hybridization.
9582194 1998 A map of 75 human ribosomal protein genes.
8722009 Structure and evolution of mammalian ribosomal proteins.
7821789 1994 Construction of a human full-length cDNA bank.
7748210 1995 [Cloning and determination of the primary structure of DNA complementary to the mRNA of human ribosomal protein L11].