Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.19
PubTator Score 2.01

Knowledge Summary

Patent

No data available

TINX Plot

Expression

AA Sequence

MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLGGHMVSDEYEQLSSEALEAARI      1 - 70
CANKYMVKSCGRDGFHMRVRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT     71 - 140
KLQNEEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAKKCLIPDGCGVKYVPSHGPLDKWR    141 - 210
VLHS                                                                      211 - 214
//

Text Mined References (13)

PMID Year Title