Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.55
PubTator Score 4.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... -1.200 7.4e-03
ovarian cancer 1.400 3.8e-04
subependymal giant cell astrocytoma 1.442 2.0e-02

 GO Component (2)

Gene RIF (1)

AA Sequence

MDTLDRVVKPKTKRAKRFLEKREPKLNENIKNAMLIKGGNANATVTKVLKDVYALKKPYGVLYKKKNITR      1 - 70
PFEDQTSLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIELGIENFVSLKDIKNSKCPEGTK     71 - 140
PMLIFAGDDFDVTEDYRRLKSLLIDFFRGPTVSNIRLAGLEYVLHFTALNGKIYFRSYKLLLKKSGCRTP    141 - 210
RIELEEMGPSLDLVLRRTHLASDDLYKLSMKMPKALKPKKKKNISHDTFGTTYGRIHMQKQDLSKLQTRK    211 - 280
MKGLKKRPAERITEDHEKKSKRIKKN                                                281 - 306
//

Text Mined References (15)

PMID Year Title