Property Summary

NCBI Gene PubMed Count 17
PubMed Score 101.96
PubTator Score 115.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
medulloblastoma, large-cell -1.200 3.4e-04
intraductal papillary-mucinous neoplasm ... 1.700 4.1e-02
lung cancer 1.500 7.0e-05
group 4 medulloblastoma -1.100 2.5e-02
nasopharyngeal carcinoma 1.100 9.7e-04
ovarian cancer 1.800 1.4e-03

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (1)

PMID Text
20923965 The binary complexes of RPE reported here will aid in the design of small molecules for modulating the activity of the enzyme and altering flux through the pentose phosphate pathway.

AA Sequence

MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMH      1 - 70
MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALV     71 - 140
MTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVI    141 - 210
NLLRNVCSEAAQKRSLDR                                                        211 - 228
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24816252 2014 An atlas of genetic influences on human blood metabolites.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20923965 2011 Conversion of D-ribulose 5-phosphate to D-xylulose 5-phosphate: new insights from structural and biochemical studies on human RPE.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15901843 2005 Alu-SINE exonization: en route to protein-coding function.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11124703 2001 Characterization of 16 novel human genes showing high similarity to yeast sequences.
7396409 1980 Biochemical genetics of the pentose phosphate cycle: human ribose 5-phosphate isomerase (RPI) and ribulose 5-phosphate 3-epimerase (RPE).
3366467 1988 Deletion 2q31.3----2q33.3: gene dosage effect of ribulose 5-phosphate 3-epimerase.
3236368 1988 Interstitial deletion 2q32.1----q34 in a child with half normal activity of ribulose 5-phosphate 3-epimerase (RPE).
2581946 1985 Phosphoribosylpyrophosphate synthesis from glucose decreases during amino acid starvation of human lymphoblasts.