Property Summary

NCBI Gene PubMed Count 47
PubMed Score 59.26
PubTator Score 40.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Epidemic typhus 6 4.262 2.1

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.200 9.6e-07
intraductal papillary-mucinous neoplasm ... 1.200 9.7e-04
lung cancer 1.400 2.5e-04
ovarian cancer 1.100 1.4e-03
Breast cancer 1.400 1.3e-05

Synonym

Accession P35244 Q549U6 RP-A p14
Symbols REPA3
RP-A p14

Gene

PDB

1L1O   1QUQ   2PI2   2PQA   2Z6K   3KDF  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (11)

PMID Text
23573956 The allele "T" of rs6947203 in the RPA3 gene acts as a protective allele in glioma.
21734401 Data indicate taht candidate genes ACTB, BZW, OCM, MACC1, NXPH1, PRPS1L1, RAC1 and RPA3, which lie within the DFNB90 region, were sequenced and no potentially causal variants were identified.
20575039 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19010961 RPA3 interacts directly with ssDNA on the 3'-side on a 31 nt ssDNA.
18270339 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17494052 Observational study of gene-disease association. (HuGE Navigator)
9084803 Replication protein A and HIV-1 nucleocapsid protein interfere with the strand displacement DNA synthesis of HIV-1 reverse transcriptase by binding to the displaced strand and keeping it away from the newly synthesized strand

AA Sequence

MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVV      1 - 70
GRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD                        71 - 121
//

Text Mined References (57)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24332808 2014 PRP19 transforms into a sensor of RPA-ssDNA after DNA damage and drives ATR activation via a ubiquitin-mediated circuitry.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24126761 2013 hPrimpol1/CCDC111 is a human DNA primase-polymerase required for the maintenance of genome integrity.
23573956 2013 TP53 and RPA3 gene variations were associated with risk of glioma in a Chinese Han population.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21734401 2011 Novel autosomal recessive nonsyndromic hearing impairment locus DFNB90 maps to 7p22.1-p15.3.
21269460 2011 Initial characterization of the human central proteome.
21221126 2012 Genome-wide association study of serious blistering skin rash caused by drugs.
21216879 2011 A genome-wide association study identifies novel loci associated with circulating IGF-I and IGFBP-3.
20575039 2010 XPC genetic polymorphisms correlate with the response to imatinib treatment in patients with chronic phase chronic myeloid leukemia.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
19996105 2010 An alternative form of replication protein a expressed in normal human tissues supports DNA repair.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19338310 2009 Streamline proteomic approach for characterizing protein-protein interaction network in a RAD52 protein complex.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
19116208 2009 An alternative form of replication protein a prevents viral replication in vitro.
19010961 2009 Evidence for direct contact between the RPA3 subunit of the human replication protein A and single-stranded DNA.
18270339 2008 Comprehensive analysis of DNA repair gene variants and risk of meningioma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17765923 2007 RPA mediates recombination repair during replication stress and is displaced from DNA by checkpoint signalling in human cells.
17494052 2007 Polymorphism discovery in 62 DNA repair genes and haplotype associations with risks for lung and head and neck cancers.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15965237 2005 Physical and functional mapping of the replication protein a interaction domain of the werner and bloom syndrome helicases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12791985 2003 Sensing DNA damage through ATRIP recognition of RPA-ssDNA complexes.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12614612 2003 Interaction and assembly of murine pre-replicative complex proteins in yeast and mouse cells.
12527904 2003 Interaction between BRCA2 and replication protein A is compromised by a cancer-predisposing mutation in BRCA2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11927569 2002 Structure of the RPA trimerization core and its role in the multistep DNA-binding mechanism of RPA.
11473323 2001 RPA governs endonuclease switching during processing of Okazaki fragments in eukaryotes.
11173472 2001 Dynamic light-scattering analysis of full-length human RPA14/32 dimer: purification, crystallization and self-association.
11081631 2000 Structural basis for the recognition of DNA repair proteins UNG2, XPA, and RAD52 by replication factor RPA.
11080452 2000 Reconstitution of the strand invasion step of double-strand break repair using human Rad51 Rad52 and RPA proteins.
10982866 2000 RBT1, a novel transcriptional co-activator, binds the second subunit of replication protein A.
10583946 1999 Quality control by DNA repair.
10473346 1999 Replication protein A (RPA): the eukaryotic SSB.
10449415 1999 The crystal structure of the complex of replication protein A subunits RPA32 and RPA14 reveals a mechanism for single-stranded DNA binding.
10214908 DNA damage recognition during nucleotide excision repair in mammalian cells.
9847074 1998 Toward a complete human genome sequence.
9826763 1998 Interaction of human rad51 recombination protein with single-stranded DNA binding protein, RPA.
9765279 1998 Replication protein A stimulates long patch DNA base excision repair.
9461578 1998 The RPA32 subunit of human replication protein A contains a single-stranded DNA-binding domain.
9430682 1998 The evolutionarily conserved zinc finger motif in the largest subunit of human replication protein A is required for DNA replication and mismatch repair but not for nucleotide excision repair.
9111189 1997 Which DNA polymerases are used for DNA-repair in eukaryotes?
8454588 1993 Cloning, overexpression, and genomic mapping of the 14-kDa subunit of human replication protein A.
8020972 1994 High-resolution genomic mapping of the three human replication protein A genes (RPA1, RPA2, and RPA3).
7760808 1995 Rpa4, a homolog of the 34-kilodalton subunit of the replication protein A complex.
7700386 1995 RPA involvement in the damage-recognition and incision steps of nucleotide excision repair.
7697716 1995 Mammalian DNA nucleotide excision repair reconstituted with purified protein components.
2159011 1990 The role of human single-stranded DNA binding protein and its individual subunits in simian virus 40 DNA replication.