Property Summary

NCBI Gene PubMed Count 104
PubMed Score 61.40
PubTator Score 102.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus -1.200 1.1e-03
ovarian cancer 1.900 5.0e-05
Waldenstrons macroglobulinemia 1.073 1.4e-02

Protein-protein Interaction (12)

PDB (10)

Gene RIF (43)

AA Sequence

MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVE      1 - 70
ISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRSFQNKKS     71 - 140
LVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQN    141 - 210
QVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE              211 - 270
//

Text Mined References (120)

PMID Year Title