Property Summary

NCBI Gene PubMed Count 166
PubMed Score 281.88
PubTator Score 385.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.757 4.4e-03
chronic lymphocytic leukemia 1.484 4.4e-03
malignant mesothelioma 1.200 6.4e-06
psoriasis 1.500 2.7e-04
glioblastoma multiforme 1.100 8.5e-18
posterior fossa group A ependymoma 1.400 4.2e-09
astrocytoma 1.900 6.6e-03
atypical teratoid/rhabdoid tumor 1.500 6.6e-06
Breast cancer 2.800 2.9e-02
group 3 medulloblastoma 1.400 2.0e-03
ovarian cancer -1.400 1.2e-03
dermatomyositis 1.500 2.1e-04

 GWAS Trait (1)

Gene RIF (115)

PMID Text
26824734 radiation induced the excessive expression RPA1 in TE-1 cells, and the radiosensitivity of TE-1R cells was less than that of TE-1 cells
26782416 Our study predicted that UBC and RPA had potential as target genes for the diagnosis and treatment of osteosarcoma
26474068 RFWD3-dependent ubiquitination of RPA regulates repair at stalled replication forks.
26366868 a significant increase in DKC1, RAD50, MRE11 and RPA1 expression in MM cases with high bone marrow infiltration (p</=0.03) and a tendency towards cases with advanced ISS stage
26145171 by targeting RPA and mimicking DNA, DSS1 functions with BRCA2 in a two-component homologous recombination mediator complex in genome maintenance and tumor suppression
26041456 The D228Y mutation in human RPA1 affects its DNA-binding activity to telomeric DNA.
25922199 FAN1 efficiently promoted DNA incision at the proper site of RPA-coated 5'-flapped DNA. Therefore, FAN1 possesses the ability to promote the ICL repair of 5'-flapped DNA covered by RPA.
25542993 Here, we introduce a number of key characteristics and concepts, including the modularity of the proteins, linkage of weak binding sites, direct competition between sites, and allostery, using the protein replication protein A (RPA). [review]
25453469 RPA70 is an intrinsically highly dynamic single-stranded DNA-binding complex during both replication and distinct steps of nucleotide excision repair.
25400143 RPA plays an important maintaining genome integrity. [Review]
25395584 BRG1-RAD52 complex mediates the replacement of RPA with RAD51 on single-stranded DNA (ssDNA) to initiate DNA strand invasion. Loss of BRG1 results in a failure of RAD51 loading onto ssDNA, abnormal homologous recombination repair
25320291 Both human RPA and hepatitis C virus NS5A(S25-C447), but not NS5A(S25-K215), enabled the NS5BDelta21-NS3 helicase complex to be stably associated with the template and synthesize RNA product in a highly processive manner in vitro.
24895130 Fanconi anemia group J (FANCJ) helicase partners with the single-stranded DNA-binding protein replication protein A (RPA) to displace BamHI-E111A bound to duplex DNA in a specific manner.
24824831 RPA by itself does not affect pol eta dependent lesion bypass fidelity when copying either 8-oxoG or T-T CPD lesions.
24565939 In addition to its annealing helicase activity, which eliminates the natural binding substrate for RPA, HARP blocks the phosphorylation of RPA by DNA-PK.
24443570 these results suggest that the PSO4 complex functionally interacts with RPA and plays an important role in the DNA damage response.
24267891 ATR-mediated suppression of dormant origins shields active forks against irreversible breakage via preventing exhaustion of nuclear RPA. This study elucidates how replicating genomes avoid destabilizing DNA damage.
24204272 LT prevents recruitment of RPA to nuclear foci after DNA damage. This leads to failure to recruit repair proteins such as Rad51 or Rad9, explaining why LT prevents repair of double strand DNA breaks by homologous recombination.
24158819 HIV-1 Vpr-induced activation of ATR increases the chromatin binding of replication protein A (RPA)
23671665 Data suggest that replication protein A (RPA) brings a complex of SMARCAL1 and WRN to stalled forks, but that they may act in different pathways to promote fork repair and restart.
23543748 RPA is a cofactor of the BLM-Topo IIIalpha-RMI1-RMI2 complex in double holliday junction dissolution
22948311 In vitro analysis of the role of replication protein A (RPA) and RPA phosphorylation in ATR-mediated checkpoint signaling.
22940245 Depletion of RPA1 abolishes HSF1 access to the promoter of HSP70 in unstressed condition and delays its rapid activation in response to heat shock.
22918586 the current understanding of RPA's roles in replication by reviewing the available structural data, DNA-binding properties, interactions with various replication proteins, and interactions with DNA repair proteins when DNA replication is stalled.
22797063 Results reveal a mechanism for the crosstalk between HR repair and NHEJ through the co-regulation of p53-RPA interaction by DNA-PK, ATM and ATR.
22510597 The radiosensitizing effect of DPYD depletion plus CPT was the additive effect of DPYD depletion and CPT.
22194613 Replication stress-induced recruitment of HDHB to chromatin is independent of checkpoint signaling but correlates with the level of replication protein A (RPA) recruited to chromatin.
22179778 cells require different RPA functions in DNA replication and DNA repair.
21935481 Study propose that RPA plays a role in the protection of the human genome cell from A3G and other deaminases when they are inadvertently diverged from their natural targets.
21901111 these data identifies unanticipated defects in the DNA damage response associated with duplications in 17p13.3 in humans involving modest RPA1 over-expression.
21859891 propose a model in which BID associates with RPA and stimulates the recruitment and/or stabilization of ATR-ATRIP to the DNA damage sensor complex
21496876 Replication protein A1, replication protein A2, and cyclins D2 and D3 seem to have a parallel role in the promotion of cell cycle in astrocytic tumors being implicated in the malignant progression of these neoplasms
21486569 Studies indicate that RPA70 SUMOylation serves as a HR mediator to facilitate recruitment of RAD51 to initiate strand invasion.
21399625 data suggest that hnRNPA1, TERRA and POT1 act in concert to displace RPA from telomeric ssDNA after DNA replication, and promote telomere capping to preserve genomic integrity
21107010 upon replication blockage, WRN and RPA functionally interact and cooperate to help properly resolve replication forks and maintain genome stability
21062395 RPA1 and RPA2 overexpression seems to be more important during early T-categories of bladder carcinogenesis, showing similar kinetics with cyclin D1
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20616048 describe an in vitro checkpoint system in which RPA-single-stranded DNA and TopBP1 are essential for phosphorylation of Chk1 by the purified ATR-ATR-interacting protein complex.
20587534 findings indicate that the L221P mutation causes a defect in ssDNA binding and a nonfunctional protein complex; this suggests that haploinsufficiency of RPA causes an increase in the levels of DNA damage and in the incidence of cancer
20575039 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20528769 RPA inhibition was considerably reduced when the length of the primers was increased
20522537 Observational study of gene-disease association. (HuGE Navigator)
20515732 Studies indicate that RPA is required for DNA replication, DNA repair, DNA recombination, and the DNA damage response pathway with roles in checkpoint activation.
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20423048 RPA significantly decreases the efficiency and the level of incorporation of complementary deoxyadenine nucleotide triphosphates and completely inhibits the incorporation of "incorrect" deoxyguanine nucleotides opposite thymine glycol.
20395205 Replication Protein A has cytotoxic activity and synergy with chemotherapeutic DNA-damaging agents
20233725 RPA-covered ssDNA not only supports recruitment and activation of ATR but also, through Tipin and Claspin, it plays an important role in the action of ATR on its critical downstream target Chk1
20184389 Small angle X-ray scattering experiments with two multidomain constructs from the N-terminus of the large subunit (RPA70) were used to examine the structural dynamics of these domains and their response to the binding of ssDNA
20167590 The microscopic evaluation of irradiation-induced Replication Protein A (RPA) foci numbers, was studied.
20139621 Expression of mutant RPA in human cancer cells causes telomere shortening.
20103649 Data show that cells subjected to chronic hypoxia the replicative restart was inhibited along with numerous replication factors including MCM6 and RPA, and cells reoxygenated after acute hypoxia underwent rapid p53-dependent apoptosis.
19854130 Ctc1-Stn1-Ten1 is a replication protein A (RPA)-like complex that is not directly involved in conventional DNA replication at forks but plays a role in DNA metabolism frequently required by telomeres.
19843584 RPA phosphorylation at the T21 and S33 sites facilitates adaptation of a DNA-replication fork to replication stress
19812417 Data support RPA enhancement of branch migration during homologous recombination repair and, conversely, POT1 limitation of inappropriate recombination and branch migration at telomeric ends.
19586055 In the response to DNA damage, the amino-terminus of RPA1 is required for Nijmegen breakage syndrome 1 protein (NBS1) and meiotic recombination 11 homolog (MRE11) binding at the DNA replication fork.
19538122 XPA formation of covalent adducts with DNA is due to the interaction of XPA with endogenous RPA.
19530647 These data show that phosphorylated RPA promoted formation of a complex with monomeric Rad52 and caused the transfer of single stranded DNA from RPA to Rad52.
19515846 MutLalpha (MLH1-PMS2), replication protein A (RPA), and HMGB1 have roles in 5'-directed mismatch repair
19419957 specific functional interaction between RPA and FANCJ on the thymine glycol substrates
19367581 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19297315 In patients with resected lung AC, ERCC1, RPA and XPF expression levels are higher in NS(Never Smoking) compared with ES(Ever Smoking).
19275579 HIV-1 Vpr-induced activation of ATR increases the chromatin binding of replication protein A (RPA)
19262689 POT1v1 and RPA are capable of stimulating WRN helicase on gapped DNA and 5'-overhang substrates, respectively
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19187036 Binding of RPA to quadruplex-forming sequences is as facile as it is to comparable non-quadruplex-forming sequences; the strength of RPA binding and unfolding of a quadruplex is dependent on the thermal stability of the quadruplex.
19165145 BLM helicase measures DNA unwound before switching strands and hRPA promotes unwinding reinitiation
19104052 replication protein A and proliferating cell nuclear antigen act as molecular switches to activate the DNA pol lambda- dependent highly efficient and faithful repair of A:8-oxo-G mismatches in human cells and to repress DNA pol beta activity.
18774935 Data show that XPC, XPA, and RPA demonstrate low specificity in binding to damaged DNA compared with undamaged DNA duplexes.
18723675 These results demonstrate that mitotic RPA hyperphosphorylation facilitates release of cells from a damaged mitosis into a 2N G(1) phase, thereby increasing cell viability.
18593712 Replication protein A stimulates the 5'- to 3'-nuclease activity of Dna2 and inhibits the 3'- to 5'-exo/endonuclease activity of Dna2.
18522944 displaced flaps with secondary structure formed during Okazaki fragment maturation can be melted by hRPA and subsequently annealed to a complementary ectopic DNA site, forming recombination intermediates that can lead to genomic instability
18515800 RPA conformation is important for regulating RPA-DNA and RPA-protein interactions
18469000 as long as a threshold of RPA1-ssDNA binding activity is met, DNA replication can occur and that an RPA1 activity separate from ssDNA binding is essential for function in DNA repair.
18438969 Recognition of new DNA nucleotide excision repair (NER) substrate analogs, 48-mer ddsDNA (damaged double-stranded DNA), by human replication protein A (hRPA) has been analyzed using fluorescence spectroscopy and photoaffinity modification.
18245774 RPA plays a regulatory role in DNA damage responses via repression of RFC2 ubiquitylation in human cells.
18003706 NBS1 mediates ATR-dependent RPA hyperphosphorylation following replication fork stall and collapse.
17981954 Observations strengthen the original pre-synaptic model, although the visualization of post-synaptic RPA foci may indicate the presence of a different role for this protein during homologous recombination.
17765923 Data suggest a direct role of RPA in homologous recombination in assembly of the RAD51 and RAD52 proteins.
17721672 Amino acid sequence conservation is not required for the conservation of dynamic behavior and presumably molecular function.
17700070 These data support a role for RPA as an initial signal/sensor for DNA damage that facilitates recruitment of MRN and ATM/ATR to sites of damage, where they then work together to fully activate the DNA damage response.
17700069 These data suggest that in response to DNA double-strand breaks, cell cycle-preferred repair pathways differentially engage RPA and the Mre11/Rad50/Nbs1 complex in repair foci.
17616578 transcription-based stress response involving RPA, ATR, and p53 has evolved as a DNA damage-sensing mechanism to safeguard cells against DNA damage-induced mutagenesis
17591703 Data demonstrate that Mre11/Rad50/Nbs1 interacts with replication protein A in unperturbed cells, that the interaction is regulated by cyclin-dependent kinases, and that this interaction is needed for MRN to correctly localize to replication centers.
17583916 Determination at single-nucleotide resolution the relative positions of the single-stranded DNA with interacting intrinsic tryptophans of RPA70.
17507928 an accurate mechanism exists to reduce the deleterious consequences of oxidative DNA damage, with an important role for PCNA and RP-A in determining a functional hierarchy among different DNA pols in lesion bypass
17494052 Observational study of gene-disease association. (HuGE Navigator)
17110927 A mechanistic model is proposed in which the ternary complex is a key intermediate that directly couples origin DNA unwinding to RPA loading on emerging ssDNA.
16893181 The location of multiple amino acids within the native RPA three-dimensional structure using reactivity of these amino acids toward proteolytic and chemical modification reagents, is studied.
16731533 phosphorylation alters the DNA binding affinity of RPA to fulfill its differential requirement at the various stages of DNA mismatch repair
16522650 DNA polymerase lambda has the ability to create base pair mismatches and human replication protein A can suppress this intrinsic in vitro mutator phenotype.
16520097 The results demonstrate that activation of a UV-induced DNA damage response pathway, involving phosphorylation of RPA p34 by DNA-PK, is enhanced in cells lacking poleta.
16306615 HIV-1 Vpr-induced activation of ATR increases the chromatin binding of replication protein A (RPA)
16082227 CDK2 inhibition modifies the dynamics of chromatin-bound minichromosome maintenance complex and replication protein A
15653682 the Mre11/Rad50/Nbs1 (MRN) complex may play a more universal role in the recognition and response to DNA lesions of all types, whereas the role of RPA may be limited to certain subsets of lesions
15456284 results obtained in this study demonstrate that a combination of exhaustive proteolysis and MALDI TOF MS can localize the sites of DNA binding to very short sequences of amino acids
15279788 the role of RPA phosphorylation in the cellular response to DNA damage is to help regulate DNA metabolism and promote DNA repair [review]
15273694 proposal that B-cell-specific AID-RPA complexes preferentially bind to ssDNA of small transcription bubbles at SHM 'hotspots', leading to AID-mediated deamination and RPA-mediated recruitment of DNA repair proteins
15180989 Replication protein A, Mre11, Rad50 and Nbs1 bind and have roles in DNA repair
15096578 RECQ1 alone is able to unwind short DNA duplexes (<110 bp), whereas considerably longer substrates (501 bp) can be unwound only in the presence of human replication protein A (hRPA)
14966274 Results suggest that replication protein A (RPA)2 phosphorylation prevents RPA association with replication centers in vivo and potentially serves as a marker for sites of DNA damage.
14747526 Papillomavirus 11 E1 protein interacts with the major ssDNA-binding domain of RPA; the interaction is substantially inhibited by ssDNA dependent on the length of the DNA
14605214 replication protein A (RPA) stimulates the binding of the Rad17-Rfc2-5 complex to single-stranded DNA
14596605 Single-stranded DNA (ssDNA) binding properties of the core domains (DBDs) of RPA are defined: DBD A is responsible for positioning and initial binding of the RPA complex while DBD A together with DBD B direct stable, high-affinity binding to ssDNA.
14499497 Human replication protein A, by engaging in both protein-protein and protein-DNA interactions, facilitates unwinding catalyzed by WRN helicase during DNA synthetic processes.
12791985 data suggest that RPA-coated ssDNA is the critical structure at sites of DNA damage that recruits the ATR-ATRIP complex and facilitates its recognition of substrates for phosphorylation and the initiation of checkpoint signaling
12486030 the multistep process of DNA damage recognition includes initiation by XPC-hHR23B, which is then replaced by the combined action of XPA and RPA
12139939 Analysis of the human replication protein A:Rad52 complex: evidence for crosstalk between RPA32, RPA70, Rad52 and DNA
12050365 interacts with Parvovirus initiator protein NS1 to coordinate replication fork progression in a reconstituted DNA replication system.
11972036 Human XPA and RPA DNA repair proteins participate in specific recognition of triplex-induced helical distortions
11968016 Human cell DNA replication is mediated by a discrete multiprotein complex. The eluted complex contains DNA polymerase delta, proliferating cell nuclear antigen, and replication protein A.
11895905 Autoantiboies to replication protein A is highly expressed and aberrantly localized in breast tumor cells
11884592 Partial reconstitution of human DNA mismatch repair in vitro: characterization of the role of human replication protein A
11479296 Sequential model of binding in which DBD-A is responsible for the initial interaction with ssDNA, that domains A, B, and C (RPA1) contact 12-23 nt of ssDNA, and that DBD-D (RPA2) is needed for RPA to interact with substrates that are 23-27 nt in length
9121429 HIV-1 Vpr-induced activation of ATR increases the chromatin binding of replication protein A (RPA)
9084803 HIV-1 Vpr-induced activation of ATR increases the chromatin binding of replication protein A (RPA)

AA Sequence

MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQ      1 - 70
LSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNEGLGQPQVAPPAPAASPAASS     71 - 140
RPQPQNGSSGMGSTVSKAYGASKTFGKAAGPSLSHTSGGTQSKVVPIASLTPYQSKWTICARVTNKSQIR    141 - 210
TWSNSRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKIANKQFTAVKNDYEMTF    211 - 280
NNETSVMPCEDDHHLPTVQFDFTGIDDLENKSKDSLVDIIGICKSYEDATKITVRSNNREVAKRNIYLMD    281 - 350
TSGKVVTATLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQ    351 - 420
ALDGVSISDLKSGGVGGSNTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNKKV    421 - 490
IDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQENQWVTCFQESAEAILGQNAAYLGELKDKNEQAFEE    491 - 560
VFQNANFRSFIFRVRVKVETYNDESRIKATVMDVKPVDYREYGRRLVMSIRRSALM                  561 - 616
//

Text Mined References (186)

PMID Year Title
26824734 2015 RPA1 expression in esophageal carcinoma and its influence on radiosensitivity of esophageal carcinoma TE-1 cells.
26782416 2015 Selecting key genes associated with osteosarcoma based on a differential expression network.
26774285 2016 HELB Is a Feedback Inhibitor of DNA End Resection.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26474068 2015 RFWD3-Dependent Ubiquitination of RPA Regulates Repair at Stalled Replication Forks.
26366868 2015 Differential Expression of Non-Shelterin Genes Associated with High Telomerase Levels and Telomere Shortening in Plasma Cell Disorders.
26145171 2015 Promotion of BRCA2-Dependent Homologous Recombination by DSS1 via RPA Targeting and DNA Mimicry.
26041456 2015 RPA prevents G-rich structure formation at lagging-strand telomeres to allow maintenance of chromosome ends.
25922199 2015 Human FAN1 promotes strand incision in 5'-flapped DNA complexed with RPA.
25542993 2015 Characteristics and concepts of dynamic hub proteins in DNA processing machinery from studies of RPA.
25453469 2014 Differential binding kinetics of replication protein A during replication and the pre- and post-incision steps of nucleotide excision repair.
25416956 2014 A proteome-scale map of the human interactome network.
25400143 2015 Replication protein A prevents promiscuous annealing between short sequence homologies: Implications for genome integrity.
25395584 2015 BRG1 promotes the repair of DNA double-strand breaks by facilitating the replacement of RPA with RAD51.
25320291 2015 Nonstructural protein 5A (NS5A) and human replication protein A increase the processivity of hepatitis C virus NS5B polymerase activity in vitro.
24895130 2014 Novel function of the Fanconi anemia group J or RECQ1 helicase to disrupt protein-DNA complexes in a replication protein A-stimulated manner.
24824831 2014 Biochemical analysis of DNA polymerase ? fidelity in the presence of replication protein A.
24565939 2014 HARP preferentially co-purifies with RPA bound to DNA-PK and blocks RPA phosphorylation.
24443570 2014 The PSO4 protein complex associates with replication protein A (RPA) and modulates the activation of ataxia telangiectasia-mutated and Rad3-related (ATR).
24332808 2014 PRP19 transforms into a sensor of RPA-ssDNA after DNA damage and drives ATR activation via a ubiquitin-mediated circuitry.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24267891 2013 ATR prohibits replication catastrophe by preventing global exhaustion of RPA.
24204272 2013 Viral interference with DNA repair by targeting of the single-stranded DNA binding protein RPA.
24126761 2013 hPrimpol1/CCDC111 is a human DNA primase-polymerase required for the maintenance of genome integrity.
23671665 2013 Identification and characterization of SMARCAL1 protein complexes.
23543748 2013 Role of replication protein A in double holliday junction dissolution mediated by the BLM-Topo III?-RMI1-RMI2 protein complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22948311 2012 In vitro analysis of the role of replication protein A (RPA) and RPA phosphorylation in ATR-mediated checkpoint signaling.
22940245 2012 RPA assists HSF1 access to nucleosomal DNA by recruiting histone chaperone FACT.
22918586 2012 The structure and function of replication protein A in DNA replication.
22797063 2013 DNA-PK, ATM and ATR collaboratively regulate p53-RPA interaction to facilitate homologous recombination DNA repair.
22510597 2012 Effects of depletion of dihydropyrimidine dehydrogenase on focus formation and RPA phosphorylation.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22194613 2012 Human DNA helicase B (HDHB) binds to replication protein A and facilitates cellular recovery from replication stress.
22179778 2012 Repair-specific functions of replication protein A.
21935481 2011 Replication protein A (RPA) hampers the processive action of APOBEC3G cytosine deaminase on single-stranded DNA.
21901111 2011 Increased RPA1 gene dosage affects genomic stability potentially contributing to 17p13.3 duplication syndrome.
21859891 2011 BID binds to replication protein A and stimulates ATR function following replicative stress.
21496876 2011 Replication protein A: a reliable biologic marker of prognostic and therapeutic value in human astrocytic tumors.
21486569 2011 SUMOylation and de-SUMOylation in response to DNA damage.
21399625 2011 TERRA and hnRNPA1 orchestrate an RPA-to-POT1 switch on telomeric single-stranded DNA.
21269460 2011 Initial characterization of the human central proteome.
21107010 2011 Molecular cooperation between the Werner syndrome protein and replication protein A in relation to replication fork blockage.
21062395 2011 Prognostic significance of replication protein A (RPA) expression levels in bladder urothelial carcinoma.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20705237 2010 Regulation of DNA repair through deSUMOylation and SUMOylation of replication protein A complex.
20616048 2010 Reconstitution of RPA-covered single-stranded DNA-activated ATR-Chk1 signaling.
20587534 2010 Functional characterization of a cancer causing mutation in human replication protein A.
20575039 2010 XPC genetic polymorphisms correlate with the response to imatinib treatment in patients with chronic phase chronic myeloid leukemia.
20528769 2010 Effect of 8-oxoguanine and abasic site DNA lesions on in vitro elongation by human DNA polymerase in the presence of replication protein A and proliferating-cell nuclear antigen.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
20515732 2010 Replication protein A: directing traffic at the intersection of replication and repair.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20423048 2010 DNA polymerases beta and lambda bypass thymine glycol in gapped DNA structures.
20395205 2010 Targeted inhibition of Replication Protein A reveals cytotoxic activity, synergy with chemotherapeutic DNA-damaging agents, and insight into cellular function.
20233725 2010 Tipin-replication protein A interaction mediates Chk1 phosphorylation by ATR in response to genotoxic stress.
20184389 2010 Structural dynamics and single-stranded DNA binding activity of the three N-terminal domains of the large subunit of replication protein A from small angle X-ray scattering.
20167590 2010 Biological dose estimation of UVA laser microirradiation utilizing charged particle-induced protein foci.
20139621 2010 Expression of mutant RPA in human cancer cells causes telomere shortening.
20103649 2010 Effects of acute versus chronic hypoxia on DNA damage responses and genomic instability.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19996105 2010 An alternative form of replication protein a expressed in normal human tissues supports DNA repair.
19854130 2009 RPA-like mammalian Ctc1-Stn1-Ten1 complex binds to single-stranded DNA and protects telomeres independently of the Pot1 pathway.
19843584 2009 Human RPA phosphorylation by ATR stimulates DNA synthesis and prevents ssDNA accumulation during DNA-replication stress.
19812417 2009 Replication protein A stimulates the Werner syndrome protein branch migration activity.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19586055 2009 Physical interaction between replication protein A (RPA) and MRN: involvement of RPA2 phosphorylation and the N-terminus of RPA1.
19538122 2009 Photoactivated DNA analogs of substrates of the nucleotide excision repair system and their interaction with proteins of NER-competent HeLa cell extract.
19530647 2009 Human replication protein A-Rad52-single-stranded DNA complex: stoichiometry and evidence for strand transfer regulation by phosphorylation.
19515846 2009 Functions of MutLalpha, replication protein A (RPA), and HMGB1 in 5'-directed mismatch repair.
19419957 2009 FANCJ helicase uniquely senses oxidative base damage in either strand of duplex DNA and is stimulated by replication protein A to unwind the damaged DNA substrate in a strand-specific manner.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19367581 2010 Identification of neuroglycan C and interacting partners as potential susceptibility genes for schizophrenia in a Southern Chinese population.
19338310 2009 Streamline proteomic approach for characterizing protein-protein interaction network in a RAD52 protein complex.
19297315 2009 The NER proteins are differentially expressed in ever smokers and in never smokers with lung adenocarcinoma.
19262689 2009 Mechanism of Werner DNA helicase: POT1 and RPA stimulates WRN to unwind beyond gaps in the translocating strand.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
19187036 2009 Circular dichroism spectra and electrophoretic mobility shift assays show that human replication protein A binds and melts intramolecular G-quadruplex structures.
19165145 2009 BLM helicase measures DNA unwound before switching strands and hRPA promotes unwinding reinitiation.
19135898 2009 Purification of proteins associated with specific genomic Loci.
19116208 2009 An alternative form of replication protein a prevents viral replication in vitro.
19104052 2008 Replication protein A and proliferating cell nuclear antigen coordinate DNA polymerase selection in 8-oxo-guanine repair.
19010961 2009 Evidence for direct contact between the RPA3 subunit of the human replication protein A and single-stranded DNA.
18774935 2008 Interaction of nucleotide excision repair factors XPC-HR23B, XPA, and RPA with damaged DNA.
18723675 2008 RPA phosphorylation facilitates mitotic exit in response to mitotic DNA damage.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18593712 2008 Processing of G4 DNA by Dna2 helicase/nuclease and replication protein A (RPA) provides insights into the mechanism of Dna2/RPA substrate recognition.
18522944 2008 Catalysis of strand annealing by replication protein A derives from its strand melting properties.
18515800 2008 Regulatory functions of the N-terminal domain of the 70-kDa subunit of replication protein A (RPA).
18469000 2008 Cellular functions of human RPA1. Multiple roles of domains in replication, repair, and checkpoints.
18438969 RPA repair recognition of DNA containing pyrimidines bearing bulky adducts.
18245774 2008 DNA damage-induced ubiquitylation of RFC2 subunit of replication factor C complex.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18003706 2007 NBS1 mediates ATR-dependent RPA hyperphosphorylation following replication-fork stall and collapse.
17981954 2007 Analysis of replication protein A (RPA) in human spermatogenesis.
17959650 2007 Replication protein A prevents accumulation of single-stranded telomeric DNA in cells that use alternative lengthening of telomeres.
17765923 2007 RPA mediates recombination repair during replication stress and is displaced from DNA by checkpoint signalling in human cells.
17721672 2007 Dynamic behavior of an intrinsically unstructured linker domain is conserved in the face of negligible amino acid sequence conservation.
17700070 2007 Replication protein A is required for etoposide-induced assembly of MRE11/RAD50/NBS1 complex repair foci.
17700069 2007 Cell cycle-and proteasome-dependent formation of etoposide-induced replication protein A (RPA) or Mre11/Rad50/Nbs1 (MRN) complex repair foci.
17673209 2007 Different activities of the largest subunit of replication protein A cooperate during SV40 DNA replication.
17666013 2007 Timed interactions between viral and cellular replication factors during the initiation of SV40 in vitro DNA replication.
17616578 2007 RPA and ATR link transcriptional stress to p53.
17591703 2007 The Mre11 complex mediates the S-phase checkpoint through an interaction with replication protein A.
17583916 2007 Structural characterization of human RPA sequential binding to single-stranded DNA using ssDNA as a molecular ruler.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17507928 2007 8-oxo-guanine bypass by human DNA polymerases in the presence of auxiliary proteins.
17494052 2007 Polymorphism discovery in 62 DNA repair genes and haplotype associations with risks for lung and head and neck cancers.
17110927 2006 Structural mechanism of RPA loading on DNA during activation of a simple pre-replication complex.
16893181 2006 Reactivity-based analysis of domain structures in native replication protein A.
16731533 2006 Regulation of replication protein A functions in DNA mismatch repair by phosphorylation.
16522650 2006 Human replication protein A can suppress the intrinsic in vitro mutator phenotype of human DNA polymerase lambda.
16520097 2006 UV-induced RPA phosphorylation is increased in the absence of DNA polymerase eta and requires DNA-PK.
16438930 2006 Direct interaction between cohesin complex and DNA replication machinery.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16135809 2005 Sumoylation of the novel protein hRIP{beta} is involved in replication protein A deposition in PML nuclear bodies.
16082227 2005 Human CDK2 inhibition modifies the dynamics of chromatin-bound minichromosome maintenance complex and replication protein A.
15965237 2005 Physical and functional mapping of the replication protein a interaction domain of the werner and bloom syndrome helicases.
15897895 2005 Interaction and colocalization of Rad9/Rad1/Hus1 checkpoint complex with replication protein A in human cells.
15775963 2005 BLAP75, an essential component of Bloom's syndrome protein complexes that maintain genome integrity.
15735006 2005 p53 modulates RPA-dependent and RPA-independent WRN helicase activity.
15653682 2005 DNA lesion-specific co-localization of the Mre11/Rad50/Nbs1 (MRN) complex and replication protein A (RPA) to repair foci.
15620706 2005 Loss of RPA1 induces Chk2 phosphorylation through a caffeine-sensitive pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456284 2004 Mass spectrometry of UV-cross-linked protein-nucleic acid complexes: identification of amino acid residues in the single-stranded DNA-binding domain of human replication protein A.
15279788 Replication protein A phosphorylation and the cellular response to DNA damage.
15273694 2004 Replication protein A interacts with AID to promote deamination of somatic hypermutation targets.
15180989 2004 Replication protein A and the Mre11.Rad50.Nbs1 complex co-localize and interact at sites of stalled replication forks.
15096578 2004 Analysis of the unwinding activity of the dimeric RECQ1 helicase in the presence of human replication protein A.
14966274 2004 Replication protein A (RPA) phosphorylation prevents RPA association with replication centers.
14747526 2004 Recruitment of replication protein A by the papillomavirus E1 protein and modulation by single-stranded DNA.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14605214 2003 Replication protein A-mediated recruitment and activation of Rad17 complexes.
14596605 2003 Replication protein A interactions with DNA: differential binding of the core domains and analysis of the DNA interaction surface.
14499497 The N-terminal domain of the large subunit of human replication protein A binds to Werner syndrome protein and stimulates helicase activity.
12791985 2003 Sensing DNA damage through ATRIP recognition of RPA-ssDNA complexes.
12754299 2003 Participation of kin17 protein in replication factories and in other DNA transactions mediated by high molecular weight nuclear complexes.
12621583 2003 Refinement of a 400-kb critical region allows genotypic differentiation between isolated lissencephaly, Miller-Dieker syndrome, and other phenotypes secondary to deletions of 17p13.3.
12614612 2003 Interaction and assembly of murine pre-replicative complex proteins in yeast and mouse cells.
12527904 2003 Interaction between BRCA2 and replication protein A is compromised by a cancer-predisposing mutation in BRCA2.
12486030 2003 Biochemical analysis of the damage recognition process in nucleotide excision repair.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12181327 2002 A dominant-negative mutant of human DNA helicase B blocks the onset of chromosomal DNA replication.
12171929 2002 A proteomics approach to identify proliferating cell nuclear antigen (PCNA)-binding proteins in human cell lysates. Identification of the human CHL12/RFCs2-5 complex as a novel PCNA-binding protein.
12139939 2002 Analysis of the human replication protein A:Rad52 complex: evidence for crosstalk between RPA32, RPA70, Rad52 and DNA.
12077133 2002 Rad52 protein associates with replication protein A (RPA)-single-stranded DNA to accelerate Rad51-mediated displacement of RPA and presynaptic complex formation.
11972036 2002 Human XPA and RPA DNA repair proteins participate in specific recognition of triplex-induced helical distortions.
11968016 2002 Human cell DNA replication is mediated by a discrete multiprotein complex.
11950880 2002 The time course and chromosomal localization of recombination-related proteins at meiosis in the mouse are compatible with models that can resolve the early DNA-DNA interactions without reciprocal recombination.
11927569 2002 Structure of the RPA trimerization core and its role in the multistep DNA-binding mechanism of RPA.
11751427 2001 UV-induced DNA incision and proliferating cell nuclear antigen recruitment to repair sites occur independently of p53-replication protein A interaction in p53 wild type and mutant ovarian carcinoma cells.
11479296 2001 Functional analysis of the four DNA binding domains of replication protein A. The role of RPA2 in ssDNA binding.
11473323 2001 RPA governs endonuclease switching during processing of Okazaki fragments in eukaryotes.
11254741 2001 Reactivity of anti-proliferating cell nuclear antigen (PCNA) murine monoclonal antibodies and human autoantibodies to the PCNA multiprotein complexes involved in cell proliferation.
11092888 2001 Human homolog of the MutY repair protein (hMYH) physically interacts with proteins involved in long patch DNA base excision repair.
11080452 2000 Reconstitution of the strand invasion step of double-strand break repair using human Rad51 Rad52 and RPA proteins.
11063722 2000 Replication protein A1 reduces transcription of the endothelial nitric oxide synthase gene containing a -786T-->C mutation associated with coronary spastic angina.
10825162 2000 Replication protein A physically interacts with the Bloom's syndrome protein and stimulates its helicase activity.
10583946 1999 Quality control by DNA repair.
10563794 1999 Interactions of human nucleotide excision repair protein XPA with DNA and RPA70 Delta C327: chemical shift mapping and 15N NMR relaxation studies.
10473346 1999 Replication protein A (RPA): the eukaryotic SSB.
10373438 1999 Functional and physical interaction between WRN helicase and human replication protein A.
10214908 DNA damage recognition during nucleotide excision repair in mammalian cells.
10064605 1999 Replication-mediated DNA damage by camptothecin induces phosphorylation of RPA by DNA-dependent protein kinase and dissociates RPA:DNA-PK complexes.
9826763 1998 Interaction of human rad51 recombination protein with single-stranded DNA binding protein, RPA.
9765279 1998 Replication protein A stimulates long patch DNA base excision repair.
9699634 1998 Solution structure of the DNA- and RPA-binding domain of the human repair factor XPA.
9461578 1998 The RPA32 subunit of human replication protein A contains a single-stranded DNA-binding domain.
9430682 1998 The evolutionarily conserved zinc finger motif in the largest subunit of human replication protein A is required for DNA replication and mismatch repair but not for nucleotide excision repair.
9396813 1997 Identification of DNA replication and cell cycle proteins that interact with PCNA.
9214288 1997 Role of protein-protein interactions in the function of replication protein A (RPA): RPA modulates the activity of DNA polymerase alpha by multiple mechanisms.
9121429 1997 The human immunodeficiency virus transactivator Tat interacts with the RNA polymerase II holoenzyme.
9111189 1997 Which DNA polymerases are used for DNA-repair in eukaryotes?
8990123 1997 Structure of the single-stranded-DNA-binding domain of replication protein A bound to DNA.
8756712 1996 Functional domains of the 70-kilodalton subunit of human replication protein A.
8454588 1993 Cloning, overexpression, and genomic mapping of the 14-kDa subunit of human replication protein A.
8420996 1993 Type I human complement C2 deficiency. A 28-base pair gene deletion causes skipping of exon 6 during RNA splicing.
8381428 1993 An interaction between replication protein A and SV40 T antigen appears essential for primosome assembly during SV40 DNA replication.
8020972 1994 High-resolution genomic mapping of the three human replication protein A genes (RPA1, RPA2, and RPA3).
7760808 1995 Rpa4, a homolog of the 34-kilodalton subunit of the replication protein A complex.
7700386 1995 RPA involvement in the damage-recognition and incision steps of nucleotide excision repair.
7697716 1995 Mammalian DNA nucleotide excision repair reconstituted with purified protein components.
7565690 1995 An interaction between the DNA repair factor XPA and replication protein A appears essential for nucleotide excision repair.
2159011 1990 The role of human single-stranded DNA binding protein and its individual subunits in simian virus 40 DNA replication.
2050703 1991 Characterization of a cDNA encoding the 70-kDa single-stranded DNA-binding subunit of human replication protein A and the role of the protein in DNA replication.
1311258 1992 Interaction of DNA polymerase alpha-primase with cellular replication protein A and SV40 T antigen.