Property Summary

NCBI Gene PubMed Count 16
PubMed Score 53.26
PubTator Score 20.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.300 1.0e-04
osteosarcoma 1.391 8.1e-04
ovarian cancer 1.600 3.2e-05

Gene RIF (5)

AA Sequence

MSSRPGREDVGAAGARRPREPPEQELQRRREQKRRRHDAQQLQQLKHLESFYEKPPPGLIKEDETKPEDC      1 - 70
IPDVPGNEHAREFLAHAPTKGLWMPLGKEVKVMQCWRCKRYGHRTGDKECPFFIKGNQKLEQFRVAHEDP     71 - 140
MYDIIRDNKRHEKDVRIQQLKQLLEDSTSDEDRSSSSSSEGKEKHKKKKKKEKHKKRKKEKKKKKKRKHK    141 - 210
SSKSNEGSDSE                                                               211 - 221
//

Text Mined References (16)

PMID Year Title