Property Summary

NCBI Gene PubMed Count 86
PubMed Score 116.23
PubTator Score 590.61

Knowledge Summary

Patent (8,367)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.400 1.5e-166

Protein-protein Interaction (7)

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
463147 screening 0 / 0 / 6 Late stage assay provider counterscreen from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptors (RORA): luminescence-based cell-based assay to identify RORG inhibitors
463151 confirmatory 0 / 0 / 1 Late stage assay provider counterscreen from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptors (RORA): luminescent-based dose response assay to identify RORG inhibitors
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors
624276 confirmatory 1 / 0 / 0 Late stage assay provider counterscreen from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptor Gamma (RORC): radioligand binding for ROR gamma using Scintillation Proximity Assay (SPA)
624277 other 1 / 0 / 0 Late stage assay provider counterscreen from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptor Gamma (RORC): Luminescence-based cell-based assays using RORE-Luc, IL-17-Luc, and ABCA1-Luc Reporters
624279 confirmatory 1 / 0 / 0 Late stage assay provider counterscreen from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptor Gamma (RORC): luminescence-based cell-based dose response panel assay against ROR alpha, ROR gamma, LXR, FXR, and VP16

Gene RIF (68)

PMID Text
27082299 A high copy number of T-bet and GATA-3 confers susceptibility to AAU and AS, and a high copy number of FOXP3 confers susceptibility to female patients with AAU either with or without AS.
26878233 Results reveal differential requirements for ROR-gammat in the maintenance of TH17 cell and group 3 innate lymphoid cell responses in intestinal inflammation.
26640126 Binding at this non-canonical site induces an unprecedented conformational reorientation of helix 12 in the RORgammat ligand binding domain.
26564244 High RORgammaT expression is associated with lymph node metastasis in Colorectal Cancer.
26549310 RORgammat is acetylated, and this acetylation is reciprocally regulated by the histone acetyltransferase p300 and the histone deacetylase HDAC1.
26498317 The findings suggest that RORC plays a significant role in the dysregulated immune response associated with lupus erythematosus (SLE) .
26474968 The mRNA expression of RORC, TNF-alpha and IL-6 was significantly high in CC patients
26453305 findings reveal a direct link between TRAF5-mediated ubiquitination and RORgammat protein regulation
26434354 the balance between the transcription factors of Treg and Th17 cells (FoXp3 and RORgammat) was sought as a molecular marker of disease activity and to highlight the pathogenesis of autoimmune liver diseases
26415373 RORgammat mRNA increased with tumor size and multiple tumor foci in hepatocellular carcinoma
26330273 melatonin suppresses HIF-1alpha accumulation and VEGF generation via inhibition of melatonin nuclear receptor RZR/RORgamma in SGC-7901 cells under hypoxia.
26319393 High RORC2 expression is associated with non-small cell lung cancer.
26267538 Data show that the number of retinoic-acid-related orphan receptor (RORC1/RORgamma) monocytic and granulocytic myeloid-derived suppressor cells (M-MDSCs) and polymorphonuclear-myeloid-derived suppressor cells increased in colorectal cancer patients.
26160376 this study reports the discovery of bi-allelic RORC loss-of-function mutations in seven individuals from three kindreds of different ethnic origins with both candidiasis and mycobacteriosis.
25873156 Our study showed that high CNVs of Rorc and low CNVs of Foxp3 confer risk for BD but not for VKH syndrome.
25872376 Expression of mRNA of transcription factors RORC2 and FoxP3 in lymphocytes in patients with pulmonary tuberculosis reflects the stages of disease progression and prognosis.
25821221 USP4 and IL-17 mRNA, but not RORgammat mRNA, were significantly elevated in CD4(+) T cells from patients with rheumatic heart disease
25769926 These results demonstrate that estradiol upregulates REA expression and recruits REA via ERalpha to the EREs on the RORgammaT promoter region, thus inhibiting RORgammaT expression and Th17 differentiation.
25740946 Demethylation of the RORC2 and IL17A in human CD4+ T lymphocytes defines Th17 origin of nonclassic Th1 cells.
25552913 The mRNA levels of RORC in peripheral blood lymphocytes of hepatocellular carcinoma patients were significantly increased, indicating the existence of a predominant phenomenon of Treg-expressing peripheral blood lymphocytes in hepatocellular carcinoma.
25527718 RORgammat-specific transcriptional interactomic inhibition suppresses autoimmunity associated with TH17 cells.
25499021 Data show that co-culturing with exopolysaccharides from Cyanobacterium aponinum (EPS-Ca) treated dendritic cells (DCs) reduced the IL-17+RORgammat+/IL-10+FoxP3+ ratio in CD4+ T cells.
25491772 Increased expression of the Th17-IL-6R/pSTAT3/BATF/RorgammaT-axis in the tumoural region of adenocarcinoma as compared to squamous cell carcinoma of the lung
25341687 The QSAR models and the results of molecular docking, MD simulation, binding free energies corroborate well with each other and further provide insights regarding the development of novel RORgt inhibitors with better activity
25292313 Data show that the expression levels of transcription factors GATA-3 and FOXP3 were upregulated with 1.0 mug/ml galectin-1, while transcription factors TBX21 and RORC expression levels were reduced with both 1.0 and 2.0 mug/ml concentrations of galectin-1.
25070893 Our data reveal a molecular mechanism in which RORgammat expression in Th17 cells can be positively regulated by USP17, thereby modulating Th17 cell functions.
24911119 This study demonstrates the role and significant correlation between a histone methyltransferase (PRMT2)-dependent signature, RORgamma, the cell-cycle regulation, DNA repair circuits, and breast cancer survival outcomes.
24812667 In Th17 cells, RORC repressed EP2 by directly silencing PTGER2 transcription, and knock down of RORC restored EP2 expression in Th17 cells.
24668754 20(OH)D3 and 20,23(OH)2D3 act as antagonists or inverse agonists of RORalpha and RORgamma.
24516202 Data suggest that RORgammat is a tractable drug target for the treatment of cutaneous inflammatory disorders.
24317395 Neutrophils, but not mast cells, coexpressed the IL-17-associated transcription factor RORgammat and were able to form extracellular traps.
23990625 Increased plasmacytoid dendritic cells and RORgammat-expressing immune effectors in cutaneous acute graft-versus-host disease.
23765061 Expression of RORC in nasal epithelial cells was higher in nasal polyps compared to control mucosa.
23726039 Defective TH17 development in human neonatal T cells involves reduced RORC2 mRNA content
23409930 Collectively, these data suggest that FoxP3 interacts with RORgammat transcription factor in a viral load-dependent fashion and brings about negative impact on IL-17 production in HIV-1 infection.
23327801 Data suggest that expression of RORC and interleukin-17 is up-regulated in mononuclear cells cultured with interleukin-23 but only in cells from subjects with Graves disease; this response is independent of thyroid function (i.e., euthyroid or not).
23211525 SULT2A1 as a novel ROR-alpha and ROR-gamma target gene.
23043388 study to evaluate gene expression of RORalpha and RORgammat and their potential role in acute-on-chronic hepatitis B liver failure (ACHBLF); mRNA level of RORgammat was positively correlated with model of end-stage liver disease (MELD) score; RORgammat plays an important role in the pathogenesis of ACHBLF
22989874 Data indicate that the dominance of the SLAMF3/SLAMF6 pathway in inducing IL-17A production can be attributed to an increased nuclear abundance and recruitment of RORgammat to the IL17A promoter.
22891280 Analysis of human RORgammaT promoter demonstrates the role of USF-1 and USF-2 transcription factors in regulating the expression of RORgammaT in human lymphocytes.
22404826 Single nucleotide polymorphisms in RORC gene is associated with lymphedema after breast cancer.
22326581 High IL4I1 mRNA expression was detectable in Th17 cell precursors and was strictly dependent on Th17 cell master gene, the retinoid acid related orphan receptor (RORC).
22237416 RORgammat repressor isoform, RORgammat-Delta(5-8) may arbitrate IL-17 production in human T cells.
22058032 By allying with HIF1alpha, RORgammat wins the fight against FoxP3 and Treg cell commitment.
21791252 Our data show a decreased Foxp3 expression and an increased ROR gamma t expression in COPD patients and normal smokers that parallels the aggravation of the disease.
21566134 Ursolic acid suppresses interleukin-17 (IL-17) production by selectively antagonizing the function of RORgamma t protein.
21455110 RORgammat determined Th17 cell might be involved with increased IL-17A in Behcet's Disease.
21426710 RORC2 and IL-17 are involved in the inflammatory response of allergic rhinitis and can be used as an indicator to judge the severity.
21391996 Studies indicate that innate lymphocyte subset co-expressing RORgammat, NK cell receptors, and Il-22 has been identified.
20450585 Compared with healthy volunteers, patients with gastric cancer showed higher levels of RORgammat and FoxP3 in PBMC.
20427770 this study identifies RORC2 as a polarizing factor in transcriptional cross-regulation
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20211758 RORalpha and RORgamma display an overlapping ligand preference with another class of oxysterol nuclear receptors, the liver X receptors (LXRalpha [NR1H3] and LXRbeta [NR1H2]).
20203100 Data showed that hydroxycholesterols promote the recruitment of coactivators by RORgamma, crystal structures reveal the binding modes of various hydroxycholesterols in the RORgamma pocket, with the receptors adopting the canonical active conformation.
20106535 higher expression in peripheral blood lymphocytes and decidua of recurrent spontaneous abortion patients
19965867 RORalpha and RORgamma are ligand-regulated members of the NR superfamily and may serve as sensors for 7-oxygenated sterols.
19692128 Encephalitogenic T cells can be divided into those that are ROR gamma t negative and those that are positive.
19648312 There is an increased synovial expression of the transcription factor of Th17, RORC2, in juvenile idiopathic arthritis and an inverse relationship with FOXP3 mRNA.
19449310 Findings demonstrate that expression of RORC2 in T cells has functional consequences beyond altering cytokine production and provides insight into the factors regulating the development of human Th17 cells.
19439651 human memory Tregs secrete IL-17 ex vivo and constitutively express RORgamma t
19112760 the authors identify the upregulation of the TH17 lymphocyte subset transcription factor retinoid orphan receptor gamma T in contact sensitivity
19029904 Expression of the transcription factor RORgammat defined a previously unknown subset of NKp46+CD3- lymphocytes.
18564921 Observational study of gene-disease association. (HuGE Navigator)
18434325 Foxp3 inhibits RORgammat-mediated IL-17A mRNA transcription through direct interaction with RORgammat
17504012 Review highlights the regulation of IL-17 production by orphan nuclear receptor ROR gamma t, which dictates the differentiation of pro-inflammatory T helper 17 (TH17) cells and is a therapeutic target for intervention of inflammatory autoimmunity.
17240331 transcription factor driving the development of IL-17-producing T cells
12855222 data suggest that RORC cannot explain the linkage of type 2 diabetes in the 1q21-q23 region
11983153 We review here recent studies on the glucocorticoid receptor and the orphan receptors Nur77 and RORgamma

AA Sequence

MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQ      1 - 70
QNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAG     71 - 140
AQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGK    141 - 210
AEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKS    211 - 280
YRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQI    281 - 350
VLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALY    351 - 420
TALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLH    421 - 490
PIVVQAAFPPLYKELFSTETESPVGLSK                                              491 - 518
//

Text Mined References (92)

PMID Year Title
27082299 2016 Association of T-Bet, GATA-3, RORC, and FOXP3 Copy Number Variations With Acute Anterior Uveitis With or Without Ankylosing Spondylitis in Chinese Han.
26878233 2016 Transient inhibition of ROR-?t therapeutically limits intestinal inflammation by reducing TH17 cells and preserving group 3 innate lymphoid cells.
26640126 2015 Identification of an allosteric binding site for ROR?t inhibition.
26564244 2016 A High ROR?T/CD3 Ratio is a Strong Prognostic Factor for Postoperative Survival in Advanced Colorectal Cancer: Analysis of Helper T Cell Lymphocytes (Th1, Th2, Th17 and Regulatory T Cells).
26549310 2015 Reciprocal regulation of ROR?t acetylation and function by p300 and HDAC1.
26498317 2016 Down-regulation of expression of retinoid acid-related orphan receptor C (RORC) in systemic lupus erythematosus.
26474968 2015 The existence of Th22, pure Th17 and Th1 cells in CIN and Cervical Cancer along with their frequency variation in different stages of cervical cancer.
26453305 2015 TRAF5-mediated Lys-63-linked Polyubiquitination Plays an Essential Role in Positive Regulation of ROR?t in Promoting IL-17A Expression.
26434354 2015 A molecular marker of disease activity in autoimmune liver diseases with histopathological correlation; FoXp3/ROR?t ratio.
26415373 2015 IL-17 Producing Cells and ROR?t mRNA Transcriptional Factor in Cirrhotic and HCC Egyptian Patients.
26330273 2015 Involvement of nuclear receptor RZR/ROR? in melatonin-induced HIF-1? inactivation in SGC-7901 human gastric cancer cells.
26319393 2016 Retinoic acid-related orphan receptor C isoform 2 expression and its prognostic significance for non-small cell lung cancer.
26267538 2015 RORC1 Regulates Tumor-Promoting "Emergency" Granulo-Monocytopoiesis.
26160376 2015 IMMUNODEFICIENCIES. Impairment of immunity to Candida and Mycobacterium in humans with bi-allelic RORC mutations.
25873156 2015 Copy number variants and genetic polymorphisms in TBX21, GATA3, Rorc, Foxp3 and susceptibility to Behcet's disease and Vogt-Koyanagi-Harada syndrome.
25872376 2015 [Expression of mRNA transcription factors RORC2 and FoxP3 in lymphocytes in patients with pulmonary tuberculosis].
25821221 2015 Cutting edge: Ubiquitin-specific protease 4 promotes Th17 cell function under inflammation by deubiquitinating and stabilizing ROR?t.
25769926 2015 Estradiol inhibits Th17 cell differentiation through inhibition of ROR?T transcription by recruiting the ER?/REA complex to estrogen response elements of the ROR?T promoter.
25740946 2015 Demethylation of the RORC2 and IL17A in human CD4+ T lymphocytes defines Th17 origin of nonclassic Th1 cells.
25552913 2015 The expression levels of transcription factors T-bet, GATA-3, ROR?t and FOXP3 in peripheral blood lymphocyte (PBL) of patients with liver cancer and their significance.
25527718 2014 ROR?t-specific transcriptional interactomic inhibition suppresses autoimmunity associated with TH17 cells.
25499021 2015 Exopolysaccharides from Cyanobacterium aponinum from the Blue Lagoon in Iceland increase IL-10 secretion by human dendritic cells and their ability to reduce the IL-17+ROR?t+/IL-10+FoxP3+ ratio in CD4+ T cells.
25491772 2014 Increased expression of the Th17-IL-6R/pSTAT3/BATF/Ror?T-axis in the tumoural region of adenocarcinoma as compared to squamous cell carcinoma of the lung.
25341687 2015 3D-QSAR, molecular docking and molecular dynamics studies of a series of ROR?t inhibitors.
25292313 2015 The effects of galectin-1 on the gene expression of the transcription factors TBX21, GATA-3, FOXP3 and RORC.
25070893 2014 The E3 deubiquitinase USP17 is a positive regulator of retinoic acid-related orphan nuclear receptor ?t (ROR?t) in Th17 cells.
24911119 2014 PRMT2 and ROR? expression are associated with breast cancer survival outcomes.
24812667 2014 Decreased RORC-dependent silencing of prostaglandin receptor EP2 induces autoimmune Th17 cells.
24668754 2014 ROR? and ROR ? are expressed in human skin and serve as receptors for endogenously produced noncalcemic 20-hydroxy- and 20,23-dihydroxyvitamin D.
24516202 2014 Pharmacologic inhibition of ROR?t regulates Th17 signature gene expression and suppresses cutaneous inflammation in vivo.
24317395 2014 In vivo induction of cutaneous inflammation results in the accumulation of extracellular trap-forming neutrophils expressing ROR?t and IL-17.
23990625 2013 Increased plasmacytoid dendritic cells and ROR?t-expressing immune effectors in cutaneous acute graft-versus-host disease.
23765061 2014 Staphylococcal enterotoxin B induced expression of IL-17A in nasal epithelial cells and its association with pathogenesis of nasal polyposis.
23726039 2013 Defective TH17 development in human neonatal T cells involves reduced RORC2 mRNA content.
23555304 2013 Dynamic circadian protein-protein interaction networks predict temporal organization of cellular functions.
23409930 2013 Loss of ROR?t DNA binding activity inhibits IL-17 expression in HIV-1 infected Indian individuals.
23327801 2013 The role of the IL-23/IL-17 axis in the pathogenesis of Graves' disease.
23211525 2013 Regulation of the human hydroxysteroid sulfotransferase (SULT2A1) by ROR? and ROR? and its potential relevance to human liver diseases.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23043388 2012 Increased peripheral ROR? and ROR?t mRNA expression is associated with acute-on-chronic hepatitis B liver failure.
22989874 2012 CD3-T cell receptor co-stimulation through SLAMF3 and SLAMF6 receptors enhances ROR?t recruitment to the IL17A promoter in human T lymphocytes.
22891280 2012 Upstream stimulating factors regulate the expression of ROR?T in human lymphocytes.
22789990 2012 Action of RORs and their ligands in (patho)physiology.
22404826 2012 Possible genetic predisposition to lymphedema after breast cancer.
22326581 2012 Rarity of human T helper 17 cells is due to retinoic acid orphan receptor-dependent mechanisms that limit their expansion.
22237416 2012 A novel isoform of the orphan receptor ROR?t suppresses IL-17 production in human T cells.
22170608 2011 Cryptochromes mediate rhythmic repression of the glucocorticoid receptor.
22058032 2011 Romance of the three kingdoms: RORgammat allies with HIF1alpha against FoxP3 in regulating T cell metabolism and differentiation.
21853531 2011 Adipogenesis and insulin sensitivity in obesity are regulated by retinoid-related orphan receptor gamma.
21791252 2011 The expression of Foxp3 and ROR gamma t in lung tissues from normal smokers and chronic obstructive pulmonary disease patients.
21566134 2011 Ursolic acid suppresses interleukin-17 (IL-17) production by selectively antagonizing the function of RORgamma t protein.
21499262 2011 Suppression of TH17 differentiation and autoimmunity by a synthetic ROR ligand.
21455110 2011 Expression of Th-17 and ROR?t mRNA in Behçet's Disease.
21426710 2011 [Relationship between allergic symptoms and RORC2 and IL-17 in patients with allergic rhinitis].
21391996 2011 Control of epithelial cell function by interleukin-22-producing ROR?t+ innate lymphoid cells.
20450585 2010 [Detection and significance of transcription factors and cytokines of Th17/Treg cells in peripheral blood in the gastric cancer patients].
20427770 2010 RORC2 is involved in T cell polarization through interaction with the FOXP3 promoter.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20211758 2010 A second class of nuclear receptors for oxysterols: Regulation of RORalpha and RORgamma activity by 24S-hydroxycholesterol (cerebrosterol).
20203100 2010 Structural basis for hydroxycholesterols as natural ligands of orphan nuclear receptor RORgamma.
20106535 2010 Increased prevalence of T helper 17 (Th17) cells in peripheral blood and decidua in unexplained recurrent spontaneous abortion patients.
19965867 2010 Modulation of retinoic acid receptor-related orphan receptor alpha and gamma activity by 7-oxygenated sterol ligands.
19692128 2009 Encephalitogenic T cells that stably express both T-bet and ROR gamma t consistently produce IFNgamma but have a spectrum of IL-17 profiles.
19648312 2009 Th17 transcription factor RORC2 is inversely correlated with FOXP3 expression in the joints of children with juvenile idiopathic arthritis.
19449310 2009 The role of retinoic acid-related orphan receptor variant 2 and IL-17 in the development and function of human CD4+ T cells.
19439651 2009 Human memory FOXP3+ Tregs secrete IL-17 ex vivo and constitutively express the T(H)17 lineage-specific transcription factor RORgamma t.
19381306 2009 Retinoid-related orphan receptors (RORs): critical roles in development, immunity, circadian rhythm, and cellular metabolism.
19112760 2008 Expression of CD70 and the TH17 transcription factor RORgammaT in human contact dermatitis.
19029904 2009 Influence of the transcription factor RORgammat on the development of NKp46+ cell populations in gut and skin.
18564921 2008 Candidate gene analysis in primary lymphedema.
18434325 2008 Foxp3 inhibits RORgammat-mediated IL-17A mRNA transcription through direct interaction with RORgammat.
18368049 2008 TGF-beta-induced Foxp3 inhibits T(H)17 cell differentiation by antagonizing RORgammat function.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17504012 2007 Retinoid-related orphan receptor gamma t is a potential therapeutic target for controlling inflammatory autoimmunity.
17240331 2007 T-cell subsets: the more the merrier.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12855222 2003 Molecular screening and association studies of retinoid-related orphan receptor gamma (RORC): a positional and functional candidate for type 2 diabetes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11983153 2002 Nuclear hormone receptors in T lymphocytes.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10963675 2000 Retinoid-related orphan receptor gamma (RORgamma) is essential for lymphoid organogenesis and controls apoptosis during thymopoiesis.
10875923 2000 Requirement for RORgamma in thymocyte survival and lymphoid organ development.
10602018 1999 RORgammaT, a thymus-specific isoform of the orphan nuclear receptor RORgamma / TOR, is up-regulated by signaling through the pre-T cell receptor and binds to the TEA promoter.
9403063 1997 Genomic structure and chromosomal mapping of the nuclear orphan receptor ROR gamma (RORC) gene.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7811290 1994 ROR gamma: the third member of ROR/RZR orphan receptor subfamily that is highly expressed in skeletal muscle.