Property Summary

NCBI Gene PubMed Count 118
PubMed Score 139.19
PubTator Score 147.14

Knowledge Summary

Patent (36,075)

TINX Plot

  Disease (4)

Expression

  Differential Expression (38)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.269 1.1e-02
malignant mesothelioma -1.100 1.1e-04
esophageal adenocarcinoma -1.700 2.2e-02
cutaneous lupus erythematosus -1.400 2.4e-02
ependymoma -1.100 9.4e-03
glioblastoma -1.900 2.6e-03
medulloblastoma -2.200 1.6e-03
cystic fibrosis 3.543 6.5e-08
periodontitis -1.400 7.0e-34
atypical teratoid / rhabdoid tumor -2.600 8.1e-07
medulloblastoma, large-cell -3.200 9.9e-06
primitive neuroectodermal tumor -1.900 1.4e-03
juvenile dermatomyositis 1.395 9.9e-05
Amyotrophic Lateral Sclerosis 1.061 5.5e-04
acute quadriplegic myopathy 2.008 2.3e-05
Atopic dermatitis -1.400 4.8e-04
pancreatic ductal adenocarcinoma liver m... -1.989 6.1e-03
non-small cell lung cancer -1.253 8.8e-11
intraductal papillary-mucinous adenoma (... -2.600 1.2e-02
intraductal papillary-mucinous carcinoma... -3.900 3.6e-03
intraductal papillary-mucinous neoplasm ... -2.100 4.2e-02
Hydrolethalus syndrome 1.702 2.2e-02
colon cancer -1.400 2.2e-02
adult high grade glioma -1.900 2.8e-03
pilocytic astrocytoma -1.200 1.9e-02
psoriasis -1.200 4.3e-32
subependymal giant cell astrocytoma -2.237 2.6e-02
lung adenocarcinoma -1.700 4.6e-10
Breast cancer -1.800 3.5e-12
breast carcinoma -1.100 9.2e-22
spina bifida -2.694 3.9e-02
Pick disease 1.500 4.9e-03
mucosa-associated lymphoid tissue lympho... 1.213 1.1e-02
invasive ductal carcinoma -1.200 1.5e-02
ulcerative colitis 1.700 1.2e-04
ovarian cancer -2.700 1.9e-05
pituitary cancer -1.100 3.5e-03
dermatomyositis 1.900 2.0e-04

 GO Component (2)

Protein-protein Interaction (2)

MLP Assay (8)

AID Type Active / Inconclusive / Inactive Description
2139 summary 2 / 0 / 0 Summary of probe development efforts to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR).
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
463078 other 1 / 0 / 5 Late stage assay provider results from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptors (RORA): luminescent-based assay to identify RORA inhibitors
463152 confirmatory 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptors (RORA): luminescence-based dose response assay to identify RORA inhibitors
504906 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptors (RORA): radioligand binding assay for RORa using [3H]25-hydroxycholesterol to determine whether probe candidates bind directly to RORa
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors
624277 other 1 / 0 / 0 Late stage assay provider counterscreen from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptor Gamma (RORC): Luminescence-based cell-based assays using RORE-Luc, IL-17-Luc, and ABCA1-Luc Reporters
624279 confirmatory 1 / 0 / 0 Late stage assay provider counterscreen from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptor Gamma (RORC): luminescence-based cell-based dose response panel assay against ROR alpha, ROR gamma, LXR, FXR, and VP16

Gene RIF (81)

PMID Text
26731717 status epilepticus induced by pilocarpine is able to change the expression and daily variation of RORalpha in the rat hippocampal area during the acute and silent phases
26515929 A common SNP in the RORA gene (rs2899663) was associated with a 21% reduced odds of placental abruption.
26184991 In a Han Chinese population, an association between RORA gene variation and depression personality trait was found.
25953430 Identify RORalpha as being essential to drive inflammation in experimental epidermolysis bullosa acquisita.
25892098 The RORA intronic SNP rs11632098 was associated with greater odds of reporting depressive symptoms in older adults.
25826113 Retinoid-related orphan receptor alpha has gained attention as a new candidate in stress-related disorders, especially depression.
25789810 associations between NR1D1, RORA and RORB genes and bipolar disorder.(
25668517 RORA rs12912233 alone might be a possible risk variant for epilepsy in Malaysian Chinese, but that, together with RORA rs880626 and SCN1A rs3812718, this polymorphism may have a synergistic effect in the epilepsy risk in Malaysians.
25500738 RORalpha and its target gene expressions are lower in colorectal tumor tissue compared with control colorectal tissue.
25362032 the data presented in this report are that RORA is linked in important ways to molecules that could be playing important roles in the AD etiology.
25346526 RORalpha mediates reprogramming of glucose metabolism in hepatoma cells in response to glutamine deficiency.
25129258 A cluster of RORA SNPs around rs2083074 showed an effect on psychic adverse drug reactions in the bipolar disorder.
24943193 Retinoic acid receptor-related orphan receptor-alpha (RORalpha) may be a potential risk gene for chronic obstructive pulmonary disease (COPD).
24919398 Two single nucleotide polymorphisms in RORA were associated with breast cancer in the whole sample and among postmenopausal women, and we also reported an association with CLOCK, RORA, and NPAS2 in the analyses at the gene level
24891616 These results reveal a novel link between ROR-alpha and E2F1 in regulating cell cycle progression and mammary tissue morphogenesis.
24886709 RORA variants were associated with dyslipidemia and obesity in Mexicans.
24798975 down-regulated RORalpha expression was associated with poorer prognosis in HCC patients.
24716566 TIMELESS and RORA genes may confer susceptibility to bipolar disorders and impact on circadian phenotypes
24668754 20(OH)D3 and 20,23(OH)2D3 act as antagonists or inverse agonists of RORalpha and RORgamma.
24525055 Data indicate that intellectual disability and epilepsy are frequently observed with 15q22.2 deletions including the NMDA receptor-regulated 2 gene (NARG2) and the PAR-related orphan receptor A gene (RORA).
24226095 RORalpha is a key regulator of diurnal rhythm and fasting induction of CYP8B1, which regulates bile acid composition and serum and liver cholesterol levels.
24196956 Deficiency of RORalpha caused a damped transcriptional oscillation of Npas2 in NIH 3T3 cells.
24150227 RORA genotype predicted circadian rhythm period lengthening by lithium, specifically among bipolar disorder cases.
24142618 DSG1, DSG3 and RORA values of the study group were not statistically different from control group (p > 0.05).
23922987 The retinoid-related orphan receptor RORalpha promotes keratinocyte differentiation via FOXN1.
23565190 RORA SNPs are associated with childhood asthma and show epistasis with NPSR1, and the interaction between RORA and NPSR1 may be of biological relevance.
23445660 this study reveals a novel RORalpha-dependent escape mechanism by which H5N1 prevents an effective inflammatory response of monocytes blocking NF-kappaB-dependent gene expression.
23443091 This information suggests that RORalpha is a potent tumor suppressor and a potential therapeutic target for breast cancer.
23211525 SULT2A1 as a novel ROR-alpha and ROR-gamma target gene.
23063684 the results of this study indicate that cholesterol sulfate induces filaggrin expression through increased RORalpha expression.
23063525 The enhancer of zeste homolog 2 (EZH2) methyltransferase has distinct substrate specificities for histone H3K27 and nonhistones exemplified by an orphan nuclear receptor, RORalpha.
23043388 study to evaluate the gene expression of RORalpha and RORgammat and their potential role in acute-on-chronic hepatitis B liver failure (ACHBLF); mRNA level of RORgammat was positively correlated with model of end-stage liver disease (MELD) score, but there was no correlation of RORalpha and MELD score
22869035 found an association at genome-wide levels of significance between PTSD and the retinoic acid orphan receptor alpha. receptor A (RORA) gene
22744720 Rora expression was induced by cigarette smoke in mice and cell culture. Rora-deficient mice were protected from smoke induced airspace enlargement. DNA damage may contribute to pathogenesis of emphysema and Rora has a role in responses to genotoxicity.
22538398 Genetic variants of RORA associate with depressive disorder and bipolar disorder.
22509368 We demonstrate that treatment of cancer cells with a newly described synthetic ROR agonist, SR1078, leads to p53 stabilization and induction of apoptosis.
22485150 Citrate synthase (CS) is a direct RORalpha target gene and one mechanism by which RORalpha regulates lipid metabolism is via regulation of CS expression.
22350413 showed that transcription of SEMA3F is directly regulated by RORalpha
22104449 RORA expression was downregulated in colorectal adenocarcinomas compared to normal controls and correlated with time to disease progression
22024429 retinoic acid-related orphan receptor alpha significantly activated the human NR1D1 promoter
21998696 distinct ROBO1 variants may influence the risk of wet and dry AMD, and the effects of ROBO1 on AMD risk may be modulated by RORA variants.
21818335 These results open new routes on the roles of RORalpha in glucose metabolism and carcinogenesis within cells of hepatic origin.
21514275 The regulation of RORalpha activity by PKA as well as CaMK-IV provides a new link in the signalling network that regulates metabolic processes such as glycogen and lipid metabolism.
21480365 RORalpha1 is involved in human osteoblast metabolism by stimulating osteoblast marker expression and inhibiting inflammatory responses.
21359227 RORA has the potential to be under both negative and positive feedback regulation by male and female hormones, respectively, through one of its transcriptional targets, aromatase; This further suggests a mechanism for introducing sex bias in autism.
21060049 Common variants and haplotypes within the RORA gene appear to act synergistically with the ARMS2 A69S polymorphism to increase risk of neovascular age-related macular degeneration.
21060049 Observational study of gene-disease association. (HuGE Navigator)
21043485 8 is REV-ERBalpha is a member of the nuclear receptor superfamily that functions as a receptor for the porphoryin heme. SR8278, is identified as a synthetic antagonist of the nuclear heme receptor REV-ERB.
20817722 Data demonstrate that NPAS2 is also a RORalpha and REV-ERBalpha target gene.
20800221 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20733416 No significant differences were found in the hMel-1B and RORa receptors in patients with adolescent idiopathic scoliosis compared with controls
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20375269 decreased expression of RORA and BCL-2 proteins in the autistic brain
20332535 a clear link between RORalpha, a key regulator of the mammalian clock, and FGF21, an important hormone regulating glucose and lipid homeostasis.
20211758 RORalpha and RORgamma display an overlapping ligand preference with another class of oxysterol nuclear receptors, the liver X receptors (LXRalpha [NR1H3] and LXRbeta [NR1H2]).
20174623 Observational study of gene-disease association. (HuGE Navigator)
20122401 RORalpha mediates transrepression of the Wnt/beta-catenin target genes.
20072116 Observational study of gene-disease association. (HuGE Navigator)
19965867 RORalpha and RORgamma are ligand-regulated members of the NR superfamily and may serve as sensors for 7-oxygenated sterols.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19909500 Observational study of gene-disease association. (HuGE Navigator)
19846067 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19786043 a possible role for RORA, a receptor for cholesterol, in the pathophysiology of age-related macular degeneration
19693801 Observational study of gene-disease association. (HuGE Navigator)
19041634 RORalpha is SUMOylated by both SUMO-1 and SUMO-2.
18658046 Report transcriptional activation of HIF-1 by RORalpha and discuss its role in hypoxia signaling.
17512500 Extracellular signal-regulated kinase-2 phosphorylates RORalpha4 in vitro
16632463 Results from RT-PCR, western blotting and confocal microscopy demonstrated that the MT1, MT2 and RORalpha1 melatonin receptors are expressed in the human term placental tissues and in choriocarcinoma cell lines JEG-3 and BeWo.
16539693 RORalpha1 provides neuroprotection by increasing the expression of the antioxidant proteins glutathione peroxidase 1 and peroxiredoxin 6, leading to a reduction in the accumulation of stress-induced reactive oxygen species.
15886715 We hypothesise that the obesity in this family is caused by (i) haploinsufficiency for RORa1 or, (ii) a gain of function mechanism mediated by the RORa1-UNC5C fusion gene.
15790933 RORalpha1 and RORalpha4 as transcriptional activators of human APOA5 gene expression
15781255 results suggest a novel mechanism whereby RORalpha modulates lipid metabolism and implies RORalpha as a potential target for the treatment of dyslipidemia and atherosclerosis
15662020 15d-PGJ2 induced RORalpha1 and RORalpha4 expression and inhibited TNF-alpha-induced vascular cell adhesion molecule-1 (VCAM-1) and intercellular adhesion molecule-1 (ICAM-1) expression in human umbilical vein endothelial cells
15013753 expression of Rev-erbalpha was upregulated by RORalpha1 but that upregulation was attenuated by Rev-erbalpha itself in A7r5 VSMCs.
14742449 the hypoxia-responsive region of the RORalpha4 promoter is composed of the HRE and GC-rich sequences and the transcriptional activation under hypoxia is conferred through the cooperation of HIF-1 with Sp1/Sp3
14741380 study demonstrates that overexpression of RORalpha1 and RORalpha4 inhibits TNF-alpha induced expression of VCAM-1 and ICAM-1 in human umbilical vein endothelial cells by inhibiting the NF-B signaling pathway
14722075 higher binding affinity of cholesterol sulfate translates into an increased transcriptional activity of RORalpha so cholesterol sulfate could play a crucial role in the regulation of RORalpha in vivo.
12377782 adenoviral overexpression of hRORalpha1 in HepG2 cells led to enhanced hRev-erbalpha mRNA accumulation, further confirming the physiological importance of RORalpha1 in the regulation of Rev-erbalpha expression
12168086 ROR alpha activation induces decreased expression of alpha v beta 3 integrin and increased expression of beta 4 integrin subunit
12114512 ROR(alpha) and Reverb(alpha) are expressed with a similar tissue distribution and are both induced during the differentiation of rat L6 myoblastic cells

AA Sequence

MESAPAAPDPAASEPGSSGADAAAGSRETPLNQESARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEI      1 - 70
IPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSR     71 - 140
DAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPE    141 - 210
GSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNI    211 - 280
SKSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQN    281 - 350
DQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEI    351 - 420
ALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMA    421 - 490
FKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG                                         491 - 523
//

Text Mined References (128)

PMID Year Title
26731717 2016 Pilocarpine-induced epilepsy alters the expression and daily variation of the nuclear receptor ROR? in the hippocampus of rats.
26515929 2015 Circadian clock-related genetic risk scores and risk of placental abruption.
26184991 2015 Retinoid-related orphan receptor alpha (RORA) gene variation is associated with trait depression.
25953430 2015 The retinoid-related orphan receptor alpha is essential for the end-stage effector phase of experimental epidermolysis bullosa acquisita.
25892098 2015 Associations of PER3 and RORA Circadian Gene Polymorphisms and Depressive Symptoms in Older Adults.
25826113 2015 RNA expression profiling in depressed patients suggests retinoid-related orphan receptor alpha as a biomarker for antidepressant response.
25789810 2015 Investigation of associations between NR1D1, RORA and RORB genes and bipolar disorder.
25668517 2015 RORA gene rs12912233 and rs880626 polymorphisms and their interaction with SCN1A rs3812718 in the risk of epilepsy: a case-control study in Malaysia.
25500738 2015 ROR? inhibits adipocyte-conditioned medium-induced colorectal cancer cell proliferation and migration and chick embryo chorioallantoic membrane angiopoiesis.
25416956 2014 A proteome-scale map of the human interactome network.
25362032 2015 A regulatory role for the insulin- and BDNF-linked RORA in the hippocampus: implications for Alzheimer's disease.
25346526 2015 Retinoic acid-related orphan receptor alpha reprograms glucose metabolism in glutamine-deficient hepatoma cells.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25129258 2015 Genetics of psychotropic medication induced side effects in two independent samples of bipolar patients.
24943193 2014 Genetic variations in ROR? are associated with chronic obstructive pulmonary disease.
24919398 2014 Breast cancer risk, nightwork, and circadian clock gene polymorphisms.
24891616 2014 ROR? binds to E2F1 to inhibit cell proliferation and regulate mammary gland branching morphogenesis.
24886709 2014 Amerindian-specific regions under positive selection harbour new lipid variants in Latinos.
24798975 2014 Retinoic acid receptor-related receptor alpha (RORalpha) is a prognostic marker for hepatocellular carcinoma.
24716566 2014 Association between circadian genes, bipolar disorders and chronotypes.
24668754 2014 ROR? and ROR ? are expressed in human skin and serve as receptors for endogenously produced noncalcemic 20-hydroxy- and 20,23-dihydroxyvitamin D.
24525055 2014 Overlapping microdeletions involving 15q22.2 narrow the critical region for intellectual disability to NARG2 and RORA.
24226095 2013 Retinoic acid-related orphan receptor ? regulates diurnal rhythm and fasting induction of sterol 12?-hydroxylase in bile acid synthesis.
24196956 2013 Nuclear receptor-mediated cell-autonomous oscillatory expression of the circadian transcription factor, neuronal PAS domain protein 2 (NPAS2).
24150227 2013 Genetic and clinical factors predict lithium's effects on PER2 gene expression rhythms in cells from bipolar disorder patients.
24142618 2013 Evaluation of patients with nasal polyps about the possible association of desmosomal junctions, RORA and PDE4D gene.
23922987 2013 The retinoid-related orphan receptor ROR? promotes keratinocyte differentiation via FOXN1.
23599027 2013 Genome-wide association study of age at menarche in African-American women.
23565190 2013 Interaction between retinoid acid receptor-related orphan receptor alpha (RORA) and neuropeptide S receptor 1 (NPSR1) in asthma.
23509962 2013 A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.
23445660 2013 Highly pathogenic influenza viruses inhibit inflammatory response in monocytes via activation of rar-related orphan receptor ROR?.
23443091 2012 ROR?, a potential tumor suppressor and therapeutic target of breast cancer.
23212062 2012 Genome-wide association study of clinical dimensions of schizophrenia: polygenic effect on disorganized symptoms.
23211525 2013 Regulation of the human hydroxysteroid sulfotransferase (SULT2A1) by ROR? and ROR? and its potential relevance to human liver diseases.
23063684 2012 Cholesterol sulfate induces expression of the skin barrier protein filaggrin in normal human epidermal keratinocytes through induction of ROR?.
23063525 2012 EZH2 generates a methyl degron that is recognized by the DCAF1/DDB1/CUL4 E3 ubiquitin ligase complex.
23043388 2012 Increased peripheral ROR? and ROR?t mRNA expression is associated with acute-on-chronic hepatitis B liver failure.
22869035 2013 A genome-wide association study of post-traumatic stress disorder identifies the retinoid-related orphan receptor alpha (RORA) gene as a significant risk locus.
22789990 2012 Action of RORs and their ligands in (patho)physiology.
22744720 2012 Retinoic acid-related orphan receptor-? is induced in the setting of DNA damage and promotes pulmonary emphysema.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22538398 2012 Clock gene variants in mood and anxiety disorders.
22509368 2012 Regulation of p53 stability and apoptosis by a ROR agonist.
22485150 2012 Regulation of expression of citrate synthase by the retinoic acid receptor-related orphan receptor ? (ROR?).
22424883 2012 Genome-wide association study of lung function decline in adults with and without asthma.
22350413 2012 ROR? suppresses breast tumor invasion by inducing SEMA3F expression.
22170608 2011 Cryptochromes mediate rhythmic repression of the glucocorticoid receptor.
22104449 2012 Altered expression of NFY-C and RORA in colorectal adenocarcinomas.
22024429 2012 Expression of retinoic acid-related orphan receptor alpha and its responsive genes in human endometrium regulated by cholesterol sulfate.
22010049 2012 Loci affecting gamma-glutamyl transferase in adults and adolescents show age × SNP interaction and cardiometabolic disease associations.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21998696 2011 Influence of ROBO1 and RORA on risk of age-related macular degeneration reveals genetically distinct phenotypes in disease pathophysiology.
21818335 2011 Control of gene expression by the retinoic acid-related orphan receptor alpha in HepG2 human hepatoma cells.
21628546 2011 Modulation of clock gene expression by the transcriptional coregulator receptor interacting protein 140 (RIP140).
21514275 2011 Protein kinase A activates and phosphorylates ROR?4 in vitro and takes part in ROR? activation by CaMK-IV.
21499262 2011 Suppression of TH17 differentiation and autoimmunity by a synthetic ROR ligand.
21480365 2011 Nuclear receptor retinoid-related orphan receptor ?1 modulates the metabolic activity of human osteoblasts.
21359227 2011 Sex hormones in autism: androgens and estrogens differentially and reciprocally regulate RORA, a novel candidate gene for autism.
21300955 2011 Meta-analysis of genome-wide association studies in >80 000 subjects identifies multiple loci for C-reactive protein levels.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
21060049 2010 Prospective study of common variants in the retinoic acid receptor-related orphan receptor ? gene and risk of neovascular age-related macular degeneration.
21043485 2011 Identification of SR8278, a synthetic antagonist of the nuclear heme receptor REV-ERB.
20860503 2010 A large-scale, consortium-based genomewide association study of asthma.
20817722 2010 Characterization of the core mammalian clock component, NPAS2, as a REV-ERBalpha/RORalpha target gene.
20800221 2010 Genome-wide association scan of trait depression.
20733416 2010 Evaluation of GPR50, hMel-1B, and ROR-alpha melatonin-related receptors and the etiology of adolescent idiopathic scoliosis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20375269 2010 Global methylation profiling of lymphoblastoid cell lines reveals epigenetic contributions to autism spectrum disorders and a novel autism candidate gene, RORA, whose protein product is reduced in autistic brain.
20332535 2010 Regulation of FGF21 expression and secretion by retinoic acid receptor-related orphan receptor alpha.
20211758 2010 A second class of nuclear receptors for oxysterols: Regulation of RORalpha and RORgamma activity by 24S-hydroxycholesterol (cerebrosterol).
20174623 2010 Systematic analysis of circadian genes in a population-based sample reveals association of TIMELESS with depression and sleep disturbance.
20122401 2010 RORalpha attenuates Wnt/beta-catenin signaling by PKCalpha-dependent phosphorylation in colon cancer.
20072116 2010 Differential association of circadian genes with mood disorders: CRY1 and NPAS2 are associated with unipolar major depression and CLOCK and VIP with bipolar disorder.
19965867 2010 Modulation of retinoic acid receptor-related orphan receptor alpha and gamma activity by 7-oxygenated sterol ligands.
19955433 2009 The nuclear receptor ROR(alpha) exerts a bi-directional regulation of IL-6 in resting and reactive astrocytes.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19909500 2009 Evidence for genetic association of RORB with bipolar disorder.
19846067 2010 A genomewide association study of citalopram response in major depressive disorder.
19786043 2010 Convergence of linkage, gene expression and association data demonstrates the influence of the RAR-related orphan receptor alpha (RORA) gene on neovascular AMD: a systems biology based approach.
19693801 2010 PER2 variantion is associated with depression vulnerability.
19381306 2009 Retinoid-related orphan receptors (RORs): critical roles in development, immunity, circadian rhythm, and cellular metabolism.
19041634 2009 SUMOylation of RORalpha potentiates transcriptional activation function.
18658046 2008 Transcriptional activation of HIF-1 by RORalpha and its role in hypoxia signaling.
18354202 2008 Isoform-specific inhibition of ROR alpha-mediated transcriptional activation by human FOXP3.
18005000 2008 Phosphorylation and transcriptional activity regulation of retinoid-related orphan receptor alpha 1 by protein kinases C.
17545671 2007 Cytosolic aspartate aminotransferase, a new partner in adipocyte glyceroneogenesis and an atypical target of thiazolidinedione.
17512500 2007 Extracellular signal-regulated kinase-2 phosphorylates RORalpha4 in vitro.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16632463 2006 Expression of melatoninergic receptors in human placental choriocarcinoma cell lines.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16539693 2006 Human retinoic acid receptor-related orphan receptor alpha1 overexpression protects neurones against oxidative stress-induced apoptosis.
16462772 2006 RORA, a large common fragile site gene, is involved in cellular stress response.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15886715 2005 RAR-related orphan receptor A isoform 1 (RORa1) is disrupted by a balanced translocation t(4;15)(q22.3;q21.3) associated with severe obesity.
15790933 2005 Transcriptional regulation of apolipoprotein A5 gene expression by the nuclear receptor RORalpha.
15781255 2005 Identification of the human ApoAV gene as a novel RORalpha target gene.
15662020 2005 15-deoxy-Delta12,14-prostaglandin J2 (15d-PGJ2) signals through retinoic acid receptor-related orphan receptor-alpha but not peroxisome proliferator-activated receptor-gamma in human vascular endothelial cells: the effect of 15d-PGJ2 on tumor necrosis factor-alpha-induced gene expression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15013753 2004 Rev-erbalpha upregulates NF-kappaB-responsive genes in vascular smooth muscle cells.
14742449 2004 Hypoxia-induced activation of the retinoic acid receptor-related orphan receptor alpha4 gene by an interaction between hypoxia-inducible factor-1 and Sp1.
14741380 2004 RORalpha1 and RORalpha4 suppress TNF-alpha-induced VCAM-1 and ICAM-1 expression in human endothelial cells.
14722075 2004 Crystal structure of the human RORalpha Ligand binding domain in complex with cholesterol sulfate at 2.2 A.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701856 2004 Transcription factors and nuclear receptors interact with the SWI/SNF complex through the BAF60c subunit.
14570920 2003 The co-repressor hairless protects RORalpha orphan nuclear receptor from proteasome-mediated degradation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12467577 2002 X-ray structure of the hRORalpha LBD at 1.63 A: structural and functional data that cholesterol or a cholesterol derivative is the natural ligand of RORalpha.
12377782 2002 Transcriptional regulation of human Rev-erbalpha gene expression by the orphan nuclear receptor retinoic acid-related orphan receptor alpha.
12168086 Role of the orphan nuclear receptor ROR alpha in the control of the metastatic behavior of androgen-independent prostate cancer cells.
12114512 2002 Identification of Reverb(alpha) as a novel ROR(alpha) target gene.
11554739 2001 Identification of a novel peroxisome proliferator-activated receptor (PPAR) gamma promoter in man and transactivation by the nuclear receptor RORalpha1.
11252722 2001 The orphan nuclear receptor ROR alpha is a negative regulator of the inflammatory response.
11121580 2000 Differential binding and transcriptional behaviour of two highly related orphan receptors, ROR alpha(4) and ROR beta(1).
11053433 2001 Transcriptional regulation of apolipoprotein C-III gene expression by the orphan nuclear receptor RORalpha.
10900268 2000 In vitro and in vivo evidence for orphan nuclear receptor RORalpha function in bone metabolism.
10478845 1999 Coactivators for the orphan nuclear receptor RORalpha.
9862959 1999 Exogenous expression of a dominant negative RORalpha1 vector in muscle cells impairs differentiation: RORalpha1 directly interacts with p300 and myoD.
9328355 1997 Transcriptional activation and repression by RORalpha, an orphan nuclear receptor required for cerebellar development.
8858107 1996 The metastasis suppressor candidate nucleotide diphosphate kinase NM23 specifically interacts with members of the ROR/RZR nuclear orphan receptor subfamily.
7935491 1994 RZRs, a new family of retinoid-related orphan receptors that function as both monomers and homodimers.
7926749 1994 Isoform-specific amino-terminal domains dictate DNA-binding properties of ROR alpha, a novel family of orphan hormone nuclear receptors.
7916608 1993 Identification of nuclear receptor mRNAs by RT-PCR amplification of conserved zinc-finger motif sequences.
7838158 1994 Cross-talk among ROR alpha 1 and the Rev-erb family of orphan nuclear receptors.
7706239 1995 The nuclear receptor for melatonin represses 5-lipoxygenase gene expression in human B lymphocytes.
7490103 1995 The orphan nuclear receptor ROR alpha (RORA) maps to a conserved region of homology on human chromosome 15q21-q22 and mouse chromosome 9.