Property Summary

NCBI Gene PubMed Count 88
PubMed Score 79.91
PubTator Score 131.18

Knowledge Summary

Patent (9,472)

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -2.000 6.3e-07
posterior fossa group B ependymoma 4.100 1.8e-19
sonic hedgehog group medulloblastoma 2.200 2.7e-04
cystic fibrosis -1.592 1.0e-03
Hydrolethalus syndrome -1.212 4.5e-02
ovarian cancer 1.400 4.4e-03
psoriasis -1.100 1.1e-42

Gene RIF (70)

PMID Text
26862065 the b-catenin-independent WNT score correlated with reduced overall survival only in the metastasized situation . This is in line with the in vitro results of the alternative WNT receptors ROR1 and ROR2, which foster invasion
26771355 Data show that CD13 anntigen and receptor tyrosine kinase-like orphan receptor 2 (ROR2) identify a cardiac lineage precursor pool that is capable of successful engraftment into the porcine heart.
26708384 Wnt5a-Ror2 signaling enhances expression and secretion of CXCL16 in mesenchymal stem cells thereby activating CXCR6 expressed on tumor cells to promote proliferation.
26690702 This study identifies an interaction between ROR1 and ROR2 that is required for Wnt5a signaling that promotes leukemia chemotaxis and proliferation.
26596412 results corroborated previous findings of Ryk-mediated Wnt5a effect, and suggested a role for Ror2 in the Wnt5a machinery in glioblastoma
26559837 These data suggest a mechanism where human cytomegalovirus alters the expression of the Wnt receptor ROR2 to alter Wnt5a-mediated signaling and inhibit trophoblast motility
26515598 Data show that silencing receptor tyrosine kinases (RTKs) ROR2 and ROR1 has a strong inhibitory effect on the ability of ovarian cancer cells to proliferate, migrate and invade.
26305508 Findings suggest that high receptor tyrosine kinase-like orphan receptor (ROR) 2 or proto-oncogene protein Wnt-5A (Wnt5a) expression is associated with poor prognosis in non-small cell lung cancer (NSCLC).
26284319 ROR2 gene mutations are associated with autosomal recessive robinow syndrome.
26259918 We present strong evidence that ROR2 could be used as an indicator of poor prognosis and could represent a novel therapeutic target for PDAC.
25755786 These results indicate that ROR2 is significantly correlated with cancer progression and poor prognosis in cervical cancer
25542006 Mutations in key regions of the kinase domain of Ror2 resulted in the abrogation of increased tumor growth, cell migration, and cell invasion observed with expression of wild-type Ror2.
25387569 Positive ROR2 and FRAT1 expression is associated with the progression and poor prognosis of chondrosarcoma.
25301559 These results suggest that ROR2 expression is correlated with malignant attributes of CRC and may serve as an indicator for poor prognosis in patients with CRC.
25209439 High expression of the novel Wnt receptor ROR2 is associated with breast cancer.
25029443 Human ROR1 and ROR2 are receptor tyrosine kinase-like pseudokinases.
24954533 report a three-generation Chinese family with dominant inheritance of the BDB1 limb phenotype. Sequence analysis identified a novel heterozygous base deletion (c.1396-1398delAA) in the gene ROR2 in all affected family members
24932600 this paper reports the findings on three families with recessive Robinow syndrome which were identified in India. Three mutations in ROR2 gene, two novels and one previously known mutation were observed in these patients
24158497 ROR2 is an epigenetically inactivated tumor suppressor gene that antagonizes both beta-catenin and AKT signaling in multiple various carcinomas.
24104062 Data shows that ROR1 and ROR2 are inversely expressed in melanomas and negatively regulate each other. Also, hypoxia initiates a shift of ROR1-positive melanomas to a more invasive, ROR2-positive phenotype.
23963164 DEX induces the upregulation of noncanonical Wnt ligand Wnt5a. Recombinant WNT5a protein induces CLAN formation through the noncanonical Wnt receptor ROR2/RhoA/ROCK signaling axis.
23893409 a new role for Ror2 in conveying a tonic signal to stabilize soluble beta-catenin and create a poised state of enhanced responsiveness to Wnt3a exogenous signals in RCC.
23469623 Our results do not support the relevance of ROR2/Wnt5a as biomarkers in stage 1 pure seminomas
23278988 This study demonstrated the first attempt to identify Wnt5a and Ror2 as additional mechanisms contributing to dysregulation of the non-canonical WNT signaling pathway in medulloblastoma. Ror2 may play a role as an oncosuppressor in medulloblastoma.
23238279 Sequence analysis of the gene ROR2 indicated a nonsense mutation (c.2278C>T, p.Q760X) in exon 9 in all brachydactyly type B affected individuals of the family.
23233346 review will explore the dual role of ROR2 in tumorigenesis and provide an up to date analysis of current literature in this rapidly expanding field
22992069 The unusual Asp-Leu-Gly motif in Ror2 is displaced compared with other inactive kinases, allowing the activation loop to interact directly with the tyrosine kinase domains.
22988987 ROR2 expression was not seen in any of the hematological malignancies studied.
22781592 High ROR2 expression is involved in the pathophysiology of Multiple myeloma-induced bone disease.
22493546 Data suggest that Wnt5a and Ror2 may serve as tumor suppressor genes in the development of hepatocellular carcinoma, and may serve as clinicopathologic biomarkers for prognosis in HCC patients.
22490406 Results provided evidence of linkage and association between the ROR2 gene and a gene controlling risk to non-syndromic cleft palate.
22294416 Results show that ROR2 is a useful prognostic indicator in the clinical management of these soft-tissue sarcomas and may represent a novel therapeutic target.
22293903 WNT-5a and ROR2 were more highly expressed in more severe disease states, and therefore may play a coordinated role in the occurrence and progression of osteosarcoma
22178368 Molecular analysis of the ROR2 gene in a Lebanese family with a mild form of recessive Robinow syndrome revealed the presence of a previously undescribed missense mutation: p.R272C (c.814C>T), in the cysteine-rich domain of the protein.
22128168 Wnt5a-Ror2 signaling might also be required for expression of MMP-13 gene during the development of the cartilaginous tissue.
22057548 The present study provides evidence of the significant association between ROR2 variants and the OPG/RANKL ratio in human plasma and also suggests ROR2 association with hand osteoarthritis.
21693067 We report two mentally retarded female siblings and their cognitively normal father, all carrying a similar 5.3 Mb microdeletion at 9q22.2q22.32, involving 30 genes including the ROR2 gene and and SYK gene.
21377971 2265C>A mutation in ROR2 gene is associated with Brachydactyly type B1 in Chinese family.
21342370 Results show expression of Wnt5a and Ror2 is induced during Snail-mediated epithelial-mesenchymal transition or malignant progression of cancer cells and that activated Wnt5a-Ror2 signaling confers highly motile and invasive properties on cancer cells.
21069266 Results suggest that Wnt5a plays the role of a tumor suppressor in leukemogenesis through the Wnt5a/Ror2 noncanonical signaling pathway that inhibits Wnt canonical signaling.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20591152 data show the importance of epigenetic alterations of ROR2 in colon cancer, highlighting the close interconnection between canonical and non-canonical Wnt signalling pathways in this type of tumour
20198315 Observational study of gene-disease association. (HuGE Navigator)
20185829 a unique regulation pattern for Ror2 in the VHL-HIF axis that has the potential to be applied to other cancer etiologies.
19851296 Observational study of gene-disease association. (HuGE Navigator)
19802008 Data show that ROR2 knockdown results in a decrease in signaling downstream of Wnt5A.
19724895 Observational study of gene-disease association. (HuGE Navigator)
19640924 Data showed a correlation between the severity of BDB1, the location of the mutation, and the amount of membrane-associated ROR2.
19561643 Results indicate that Wnt5a/Ror2 signaling involves the activation of a SFK, leading to MMP-13 expression, and that constitutively active Wnt5a/Ror2 signaling confers invasive properties on osteosarcoma cells in a cell-autonomous manner.
19533773 Distal symphalangism affecting only 4th finger with ROR2 mutation.
19461659 The deletion represents the second ROR2 mutation associated with a autosomal dominant brachydactyly type B1-syndactyly phenotype.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19448672 Expression of MMP2 in RCC cells was suppressed by Ror2 knockdown, placing Ror2 as a mediator of MMP2 regulation in RCC and a potential regulator of extracellular matrix remodeling.
19135982 the interaction of Ror2 with BRIb is specific and independent of post-translational N-glycosylation.
18831060 clinical and molecular findings of two sib pairs from the same extended family with Robinow syndrome due to a novel intragenic ROR2 deletion involving exons 6 and 7 that could not be detected by sequencing
18703641 Stimulation of epithelia by the CaSR increased the expression of the tyrosine kinase Ror2, suggesting existence of a unique paracrine relationship for CDX2 homoeostasis in the intestine.
18615587 both Wnt5a and Wnt3a bound Ror2, only Wnt5a induced Ror2 homo-dimerization and tyrosine phosphorylation in U2OS human osteoblastic cells.
18365018 Activation via tyrosine phosphorylation of ROR2 receptor leads to its internalisation into Rab5 positive endosomes. These findings show that BDB mutant receptors are defective in kinase activation as a result of failure to recruit Src
18215320 Ror2 positively modulates Wnt3a-activated canonical signaling in a lung carcinoma, H441 cell line. This activity of Ror2 is dependent on cooperative interactions with Fzd2 but not Fzd7.
17996904 In this study, we showed for the first time the connection of ROR2 in Dupuytren's disease
17717073 Ror2 induces osteogenic differentiation, at least in part, through a release of the 14-3-3beta-mediated inhibition
17665217 The clustering of Robinow-causing mutations in the extracellular frizzled-like cysteine-rich domain of ROR2 suggests a stringent requirement for the correct folding of the domain before export of ROR2 from the endoplasmic reticulum to the plasma membrane.
17619808 Observational study of gene-disease association. (HuGE Navigator)
17619808 The region of the first through the second ROR2 introns is most likely to contain the functional polymorphism/s responsible for hand bone length and BMD.
17101003 Brachydactyly type B1: report of a family with de novo ROR2 mutation.
17095577 Ror2 initiates commitment of MSCs to osteoblastic lineage and promotes differentiation at early and late stages of osteoblastogenesis.
15654020 The ROR2 protein modulates the growth of neurites as well as their branching pattern in hippocampal neurons.
15388793 identification of human Ror2 as a novel regulator of canonical Wnt signaling in osteoblastic (bone-forming) cells with selective activities, enhancing Wnt1 but antagonizing Wnt3
12919145 ROR2 is mutated in hereditary brachydactyly with nail dysplasia, but not in Sorsby syndrome.
12815588 Heterozygous mutations in ROR2 have recently been shown to give rise to autosomal dominant brachydactyly type B1 (BDB1).

AA Sequence

MARGSALPRRPLLCIPAVWAAAALLLSVSRTSGEVEVLDPNDPLGPLDGQDGPIPTLKGYFLNFLEPVNN      1 - 70
ITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYYQCVATNG     71 - 140
MKTITATGVLFVRLGPTHSPNHNFQDDYHEDGFCQPYRGIACARFIGNRTIYVDSLQMQGEIENRITAAF    141 - 210
TMIGTSTHLSDQCSQFAIPSFCHFVFPLCDARSRTPKPRELCRDECEVLESDLCRQEYTIARSNPLILMR    211 - 280
LQLPKCEALPMPESPDAANCMRIGIPAERLGRYHQCYNGSGMDYRGTASTTKSGHQCQPWALQHPHSHHL    281 - 350
SSTDFPELGGGHAYCRNPGGQMEGPWCFTQNKNVRMELCDVPSCSPRDSSKMGILYILVPSIAIPLVIAC    351 - 420
LFFLVCMCRNKQKASASTPQRRQLMASPSQDMEMPLINQHKQAKLKEISLSAVRFMEELGEDRFGKVYKG    421 - 490
HLFGPAPGEQTQAVAIKTLKDKAEGPLREEFRHEAMLRARLQHPNVVCLLGVVTKDQPLSMIFSYCSHGD    491 - 560
LHEFLVMRSPHSDVGSTDDDRTVKSALEPPDFVHLVAQIAAGMEYLSSHHVVHKDLATRNVLVYDKLNVK    561 - 630
ISDLGLFREVYAADYYKLLGNSLLPIRWMAPEAIMYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQD    631 - 700
VVEMIRNRQVLPCPDDCPAWVYALMIECWNEFPSRRPRFKDIHSRLRAWGNLSNYNSSAQTSGASNTTQT    701 - 770
SSLSTSPVSNVSNARYVGPKQKAPPFPQPQFIPMKGQIRPMVPPPQLYVPVNGYQPVPAYGAYLPNFYPV    771 - 840
QIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSNTSMADRAALLSEGADDTQNAPEDGAQSTVQ    841 - 910
EAEEEEEGSVPETELLGDCDTLQVDEAQVQLEA                                         911 - 943
//

Text Mined References (89)

PMID Year Title
26862065 2016 ?-catenin-independent WNT signaling and Ki67 in contrast to the estrogen receptor status are prognostic and associated with poor prognosis in breast cancer liver metastases.
26771355 2016 CD13 and ROR2 Permit Isolation of Highly Enriched Cardiac Mesoderm from Differentiating Human Embryonic Stem Cells.
26708384 2016 Wnt5a-Ror2 signaling in mesenchymal stem cells promotes proliferation of gastric cancer cells by activating CXCL16-CXCR6 axis.
26690702 2016 Wnt5a induces ROR1/ROR2 heterooligomerization to enhance leukemia chemotaxis and proliferation.
26596412 2015 Wnt5a, Ryk and Ror2 expression in glioblastoma subgroups.
26559837 2015 Human Cytomegalovirus Modulates Expression of Noncanonical Wnt Receptor ROR2 To Alter Trophoblast Migration.
26515598 2015 Targeting the ROR1 and ROR2 receptors in epithelial ovarian cancer inhibits cell migration and invasion.
26305508 2015 Over-expression of ROR2 and Wnt5a cooperatively correlates with unfavorable prognosis in patients with non-small cell lung cancer.
26284319 2015 Clinical and molecular characterization of seven Egyptian families with autosomal recessive robinow syndrome: Identification of four novel ROR2 gene mutations.
26259918 2015 High ROR2 expression in tumor cells and stroma is correlated with poor prognosis in pancreatic ductal adenocarcinoma.
25755786 2015 Up-regulation of ROR2 is associated with unfavorable prognosis and tumor progression in cervical cancer.
25542006 2014 Expression of Ror2 mediates invasive phenotypes in renal cell carcinoma.
25387569 2015 The clinical pathological significance of FRAT1 and ROR2 expression in cartilage tumors.
25301559 2014 High expression of ROR2 in cancer cell correlates with unfavorable prognosis in colorectal cancer.
25209439 2015 Expression of the novel Wnt receptor ROR2 is increased in breast cancer and may regulate both ?-catenin dependent and independent Wnt signalling.
25029443 2014 Evolutionary divergence in the catalytic activity of the CAM-1, ROR1 and ROR2 kinase domains.
24954533 2014 A new mutation in the gene ROR2 causes brachydactyly type B1.
24932600 2014 Identification of novel ROR2 gene mutations in Indian children with Robinow syndrome.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24158497 2014 Epigenetic identification of receptor tyrosine kinase-like orphan receptor 2 as a functional tumor suppressor inhibiting ?-catenin and AKT signaling but frequently methylated in common carcinomas.
24104062 2013 Hypoxia induces phenotypic plasticity and therapy resistance in melanoma via the tyrosine kinase receptors ROR1 and ROR2.
23963164 2013 Dexamethasone induces cross-linked actin networks in trabecular meshwork cells through noncanonical wnt signaling.
23893409 2013 Receptor tyrosine kinase-like orphan receptor 2 (Ror2) expression creates a poised state of Wnt signaling in renal cancer.
23469623 2013 ROR2 and Wnt5a expression in stage 1 pure testicular seminomas.
23278988 2013 Prognostic significance of Ror2 and Wnt5a expression in medulloblastoma.
23238279 2013 A nonsense mutation in the gene ROR2 underlying autosomal dominant brachydactyly type B.
23233346 2013 The dual role of the novel Wnt receptor tyrosine kinase, ROR2, in human carcinogenesis.
22992069 2012 Assessing the range of kinase autoinhibition mechanisms in the insulin receptor family.
22988987 2013 Orphan receptor tyrosine kinases ROR1 and ROR2 in hematological malignancies.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22781592 2013 Myeloma cells inhibit non-canonical wnt co-receptor ror2 expression in human bone marrow osteoprogenitor cells: effect of wnt5a/ror2 pathway activation on the osteogenic differentiation impairment induced by myeloma cells.
22688191 2012 Genome-wide association study in a Swedish population yields support for greater CNV and MHC involvement in schizophrenia compared with bipolar disorder.
22493546 2012 Loss of Wnt5a and Ror2 protein in hepatocellular carcinoma associated with poor prognosis.
22490406 2012 ROR2 gene is associated with risk of non-syndromic cleft palate in an Asian population.
22294416 2012 ROR2 is a novel prognostic biomarker and a potential therapeutic target in leiomyosarcoma and gastrointestinal stromal tumour.
22293903 2012 Expression of WNT-5a and ROR2 correlates with disease severity in osteosarcoma.
22178368 2012 Identification of a novel causative mutation in the ROR2 gene in a Lebanese family with a mild form of recessive Robinow syndrome.
22128168 2012 Dissection of Wnt5a-Ror2 signaling leading to matrix metalloproteinase (MMP-13) expression.
22057548 2012 A significant association exists between receptor tyrosine kinase-like orphan receptor 2 gene variants and the OPG/RANKL ratio in human plasma.
21693067 2011 9q22 Deletion--first familial case.
21377971 2011 [Mutation analysis of the pathogenic gene in a Chinese family with Brachydactyly type B1].
21342370 2011 Critical role of Wnt5a-Ror2 signaling in motility and invasiveness of carcinoma cells following Snail-mediated epithelial-mesenchymal transition.
21069266 2011 The Wnt5a/Ror2 noncanonical signaling pathway inhibits canonical Wnt signaling in K562 cells.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20591152 2010 Epigenetic repression of ROR2 has a Wnt-mediated, pro-tumourigenic role in colon cancer.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20185829 2010 Identification of Ror2 as a hypoxia-inducible factor target in von Hippel-Lindau-associated renal cell carcinoma.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19802008 2010 The orphan tyrosine kinase receptor, ROR2, mediates Wnt5A signaling in metastatic melanoma.
19724895 2009 Association of gene polymorphisms with chronic kidney disease in Japanese individuals.
19640924 2009 A gradient of ROR2 protein stability and membrane localization confers brachydactyly type B or Robinow syndrome phenotypes.
19561643 2009 Autonomous regulation of osteosarcoma cell invasiveness by Wnt5a/Ror2 signaling.
19533773 2009 A novel subtype of distal symphalangism affecting only the 4th finger.
19486338 2009 Orphan receptor tyrosine kinase ROR2 as a potential therapeutic target for osteosarcoma.
19461659 2009 A novel single-base deletion in ROR2 causes atypical brachydactyly type B1 with cutaneous syndactyly in a large Chinese family.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19448672 2009 Ror2, a developmentally regulated kinase, promotes tumor growth potential in renal cell carcinoma.
19135982 2009 Biochemical and functional characterization of the Ror2/BRIb receptor complex.
18831060 2008 Robinow syndrome: phenotypic variability in a family with a novel intragenic ROR2 mutation.
18703641 2008 CaSR stimulates secretion of Wnt5a from colonic myofibroblasts to stimulate CDX2 and sucrase-isomaltase using Ror2 on intestinal epithelia.
18615587 2008 Wnt5a induces homodimerization and activation of Ror2 receptor tyrosine kinase.
18365018 2008 The deleted in brachydactyly B domain of ROR2 is required for receptor activation by recruitment of Src.
18215320 2008 Ror2 modulates the canonical Wnt signaling in lung epithelial cells through cooperation with Fzd2.
17996904 2008 The expression of myoglobin and ROR2 protein in Dupuytren's disease.
17717073 2007 Homodimerization of Ror2 tyrosine kinase receptor induces 14-3-3(beta) phosphorylation and promotes osteoblast differentiation and bone formation.
17668388 2007 A new subtype of brachydactyly type B caused by point mutations in the bone morphogenetic protein antagonist NOGGIN.
17665217 2007 Novel Robinow syndrome causing mutations in the proximal region of the frizzled-like domain of ROR2 are retained in the endoplasmic reticulum.
17619808 2007 Family-based association study of ROR2 polymorphisms with an array of radiographic hand bone strength phenotypes.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17101003 2006 Brachydactyly type B1: report of a family with de novo ROR2 mutation.
17095577 2007 The orphan receptor tyrosine kinase Ror2 promotes osteoblast differentiation and enhances ex vivo bone formation.
15654020 2005 Neurite extension in central neurons: a novel role for the receptor tyrosine kinases Ror1 and Ror2.
15388793 2005 The orphan receptor tyrosine kinase Ror2 modulates canonical Wnt signaling in osteoblastic cells.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14752058 2004 O-sulfonation of serine and threonine: mass spectrometric detection and characterization of a new posttranslational modification in diverse proteins throughout the eukaryotes.
12919145 2003 ROR2 is mutated in hereditary brachydactyly with nail dysplasia, but not in Sorsby syndrome.
12839624 2003 The receptor tyrosine kinase Ror2 is involved in non-canonical Wnt5a/JNK signalling pathway.
12815588 2003 One gene, two phenotypes: ROR2 mutations in autosomal recessive Robinow syndrome and autosomal dominant brachydactyly type B.
12754255 2003 The receptor tyrosine kinase Ror2 associates with the melanoma-associated antigen (MAGE) family protein Dlxin-1 and regulates its intracellular distribution.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12011143 2002 Robinow syndrome.
11062486 2000 Corrections/Erratum
10986040 2000 Distinct mutations in the receptor tyrosine kinase gene ROR2 cause brachydactyly type B.
10932187 2000 Mutation of the gene encoding the ROR2 tyrosine kinase causes autosomal recessive Robinow syndrome.
10932186 2000 Recessive Robinow syndrome, allelic to dominant brachydactyly type B, is caused by mutation of ROR2.
10700182 2000 Dominant mutations in ROR2, encoding an orphan receptor tyrosine kinase, cause brachydactyly type B.
9973296 1999 Brachydactyly type B: linkage to chromosome 9q22 and evidence for genetic heterogeneity.
1334494 1992 A novel family of cell surface receptors with tyrosine kinase-like domain.