Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.62
PubTator Score 2.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -2.052 3.6e-05
posterior fossa group B ependymoma 4.500 1.3e-12
lung adenocarcinoma -1.800 7.0e-08
atypical teratoid/rhabdoid tumor 1.100 2.7e-02
nasopharyngeal carcinoma -2.700 2.2e-09
lung carcinoma -2.600 2.9e-08
non-small cell lung carcinoma -1.500 3.8e-09

Synonym

Accession Q96C74 D3DTC9 Q9BZX0 ROPN1-like protein
Symbols ASP
RSPH11

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
25600306 Sp17 and ASP cancer/testis antigens were found in ciliated cells of four ciliated hepatic foregut cysts (CHFCs). Further characterization of Sp17 and ASP in patients with CHFCs may provide significant clues for understanding the molecular mechanisms underlying their predisposition to develop squamous cell carcinomas.
21424380 Single nucleotide polymorphisms in ROPN1L gene is associated with breast cancer.

AA Sequence

MPLPDTMFCAQQIHIPPELPDILKQFTKAAIRTQPADVLRWSAGYFSALSRGDPLPVKDRMEMPTATQKT      1 - 70
DTGLTQGLLKVLHKQCHHKRYVELTDLEQKWKNLCLPKEKFKALLQLDPCENKIKWINFLALGCSMLGGS     71 - 140
LNTALKHLCEILTDDPEGGPARIPFKTFSYVYRYLARLDSDVSPLETESYLASLKENIDARKNGMIGLSD    141 - 210
FFFPKRKLLESIENSEDVGH                                                      211 - 230
//

Text Mined References (12)

PMID Year Title
25600306 2015 Sperm protein 17 and AKAP-associated sperm protein cancer/testis antigens are expressed in ciliated hepatic foregut cysts.
25416956 2014 A proteome-scale map of the human interactome network.
25089627 2014 Long noncoding RNA expression profiles of lung adenocarcinoma ascertained by microarray analysis.
22446040 2012 A novel locus for body mass index on 5p15.2: a meta-analysis of two genome-wide association studies.
21424380 2011 Potential novel candidate polymorphisms identified in genome-wide association study for breast cancer susceptibility.
18421703 2008 Protein kinase A RII-like (R2D2) proteins exhibit differential localization and AKAP interaction.
15489335 2004 Human ORFeome version 1.1: a platform for reverse proteomics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11278869 2001 Identification of sperm-specific proteins that interact with A-kinase anchoring proteins in a manner similar to the type II regulatory subunit of PKA.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.