Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.10
PubTator Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6514 4.2e-21
non-inflammatory breast cancer 63 2.2e-08

Expression

  Differential Expression (2)

Disease log2 FC p
non-inflammatory breast cancer -4.000 2.2e-08
psoriasis -1.200 4.2e-21

AA Sequence

MAQTDKPTCIPPELPKMLKEFAKAAIRAQPQDLIQWGADYFEALSRGETPPVRERSERVALCNWAELTPE      1 - 70
LLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKI     71 - 140
VCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVW    141 - 210
LE                                                                        211 - 212
//

Text Mined References (3)

PMID Year Title