Property Summary

NCBI Gene PubMed Count 14
PubMed Score 13.20
PubTator Score 12.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 3.0e-08
non-inflammatory breast cancer 208 3.3e-06
breast carcinoma 1614 5.7e-03
invasive ductal carcinoma 2950 1.7e-02
Disease Target Count Z-score Confidence
Opisthorchiasis 14 3.325 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma -1.800 5.7e-03
invasive ductal carcinoma -1.672 1.7e-02
psoriasis -1.300 3.0e-08
non-inflammatory breast cancer -4.500 3.3e-06

Synonym

Accession Q9HAT0 D3DN99 Q9UF38
Symbols CT91
ODF6
ROPN1A
RHPNAP1
ropporin

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

PMID Text
25704993 Ropporin gene expression is related to the sperm motility. Its abnormal expression in the sperm of asthenozoospermic men with varicocele is associated with impaired sperm motility that is improved after varicocelectomy.
22021175 Lack of ROPN1 had no effect on ciliary motility.
21654522 We suggest that ropporin is a promising target for MM immunotherapy, as we were able to generate human leukocyte antigen class I-restricted cytotoxic lymphocytes able to kill autologous MM cells.
21240291 CABYR variants form a complex not only with the scaffolding protein AKAP3 but also with another RII-like domain-containing protein in the sperm fibrous sheath.
20705794 ropporin was predominantly expressed in round spermatids in human testis, and located in the principal piece and end piece of spermatozoa flagella. Expression level of ropporin was significantly lower in asthenozoospermic men than in normozoospermic men.
20107840 One SNP (rs4499545) in the ROPN1-KALRN intergenic region showed significant allelic and genotypic association with ischemic stroke risk.
20107840 Observational study of gene-disease association. (HuGE Navigator)
17551920 Ropporin gene expression in tumor cells is associated with the presence of high titer IgG antibodies against Ropporin, suggesting the in vivo translation of the mRNA into protein and the immunogenicity of the protein to the autologous hosts.

AA Sequence

MAQTDKPTCIPPELPKMLKEFAKAAIRVQPQDLIQWAADYFEALSRGETPPVRERSERVALCNRAELTPE      1 - 70
LLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKI     71 - 140
VCEVLSCDHNGGSPRIPFSTFQFLYTYIAKVDGEISASHVSRMLNYMEQEVIGPDGIITVNDFTQNPRVQ    141 - 210
LE                                                                        211 - 212
//

Text Mined References (16)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25704993 2015 Ropporin gene expression in infertile asthenozoospermic men with varicocele before and after repair.
25416956 2014 A proteome-scale map of the human interactome network.
22021175 2012 Loss of ASP but not ROPN1 reduces mammalian ciliary motility.
21654522 Cancer testis antigen, ropporin, is a potential target for multiple myeloma immunotherapy.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21240291 2011 CABYR binds to AKAP3 and Ropporin in the human sperm fibrous sheath.
20705794 Functional expression of ropporin in human testis and ejaculated spermatozoa.
20107840 2010 Kalirin: a novel genetic risk factor for ischemic stroke.
18421703 2008 Protein kinase A RII-like (R2D2) proteins exhibit differential localization and AKAP interaction.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17551920 2007 A yeast two-hybrid system using Sp17 identified Ropporin as a novel cancer-testis antigen in hematologic malignancies.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11278869 2001 Identification of sperm-specific proteins that interact with A-kinase anchoring proteins in a manner similar to the type II regulatory subunit of PKA.
10591629 2000 Ropporin, a sperm-specific binding protein of rhophilin, that is localized in the fibrous sheath of sperm flagella.