Property Summary

NCBI Gene PubMed Count 129
PubMed Score 248.30
PubTator Score 179.14

Knowledge Summary

Patent (15,745)

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.100 1.6e-02
ependymoma -1.500 1.0e-02
oligodendroglioma -1.600 4.2e-02
esophageal adenocarcinoma 1.100 3.2e-02
osteosarcoma 2.741 1.2e-08
atypical teratoid / rhabdoid tumor -1.500 2.4e-05
medulloblastoma -1.300 2.0e-03
medulloblastoma, large-cell -1.600 1.7e-05
hereditary spastic paraplegia -1.099 1.7e-02
lung cancer 1.300 3.2e-02
ovarian cancer -1.300 1.5e-04

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
604 screening 212 / 0 / 59593 Primary biochemical high-throughput screening assay for inhibitors of Rho kinase 2 (Rhok2)
644 confirmatory 67 / 0 / 139 Dose-response biochemical assay of inhibitors of Rho kinase 2 (Rock2)
791 confirmatory 21 / 0 / 2 Dose-response biochemical assay of Rho kinase 2 (Rock2) inhibitors
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (112)

PMID Text
26928204 Uniaxial stretch activates JNK1 via RhoA and ROCK pathways in human bladder smooth muscle cells.
26901778 Rho Kinase ROCK2 Mediates Acid-Induced NADPH Oxidase NOX5-S Expression in Human Esophageal Adenocarcinoma Cells
26826790 ROCK1 and ROCK2 differentially regulate invadopodia activity through separate signaling pathways.
26818518 This study report that protein levels of the Rho-associated protein kinases (ROCK2) was increased in Progressive Supranuclear Palsy and Corticobasal Degeneration brains.
26818475 Data clearly suggests association of ROCK2 polymorphisms and haplotypes with high altitude essential hypertension in a Ladakhi Indian population.
26626121 Study shows that nuclear ROCKII activation signal might contribute to the tumor metastasis in breast cancer.
26620183 ROCK2 forms a dimer, 120 nm in length, with a long coiled-coil tether linking the kinase and membrane-binding domains.
26572751 no differences in renal interstitial fibrosis or UUOinduced ROCK activity were identified between the ROCK2 heterozygote knockout and WT mice, indicating that the genetic partial disruption of ROCK2 is insufficient for protecting against renal fibrosis.
26505794 beta-catenin/TCF4 pathway contributed to the effects of Rock2 in CRC cells, and Rock2 stabilized beta-catenin by preventing its ubiquitination and degradation
26481340 ROCK activity in MS serum was elevated compared with serum from healthy controls
26468005 We speculate that the drop of the ROCK-to-MLCK ratio may occur as an attempt to compensate for the increased Rho kinase activity.
26261605 Esophageal squamous cell carcinoma showed a positive expression of Rock2, which was significantly association with ethnic background.
25969175 miR-448 may contribute to the progression of Hepatocellular Carcinoma via regulating ROCK2 expression.
25940707 17beta-estradiol induces proliferation of uterine smooth muscle cells in endometriosis through hyperactivation of the estrogen receptor-RhoA/ROCK signaling pathway.
25916120 These results indicate that bleb formation is dependent on Rho activity (ROCK1 and ROCK 2)in ouabain-induced cell death in HUVECs
25912304 miR-144 suppresses OS progression by directly downregulating ROCK1 and ROCK2 expression.
25909223 Results demonstrated that the miR-200b/200c/429 subfamily inhibited HCC cell migration through modulating Rho/ROCK mediated cell cytoskeletal reorganization and cell-substratum adhesion.
25872785 knockdown of TMEM45A also inhibited cell adhesion as well as cell invasion. More importantly, suppression of TMEM45A notably downregulated the expression of TGF-b1, TGF-b2, RhoA and ROCK2.
25869521 ROCK2 is pivotal to baseline junctional tension as a novel mechanism by which Rho kinase primes the endothelium for hyperpermeability responses.
25840982 our data suggest that inhibition of ROCK (Rho-kinases ROCK 1 and ROCK 2)reduces the ability of melanoma cells to efficiently colonize the lungs
25771860 Data indicate that dysfunction of the Rho-associated kinase 2 (Rock2)-p-GSK3beta/beta-catenin-CCAAT/enhancer-binding protein delta (CEBPD) regulatory circuitry may contribute to the tumorigenic characteristic of hepatocellular carcinoma (HCC).
25755711 Our data indicate that expression of ROCK1 and ROCK2 are closely associated with tumor growth and lymph node metastasis of laryngeal squamous cell carcinoma
25677806 Depletion of the kinases ROCK1 and ROCK2, two known RhoC downstream effectors, similarly decreases cancer interaction with ECs
25577341 ROCK2 is required for CXCL8 responses by TNF-alpha stimulated IEC by affecting intracellular signaling through MKK4 adn JNK.
25481646 Two functional single nucleotide polymorphisms of ROCK2 increase susceptibility of arterial stiffness in the Chinese population.
25279428 miR-200b and miR-200c are suppressed in AGE-induced endothelial cell injury, resulting in unregulated RhoA/ROCK2 signaling.
25251472 upregulation of MMP2 rescued the decreased migration and invasion induced by the knockdown of Rock2, whereas the knockdown of MMP2 decreased Rock2-enhanced hepatocellular carcinoma migration and invasion
25011614 protein kinase (ROCK)-focal adhesion kinase (p-FAK cascade plays an important role in the effect of caffeine in glioma cells.
24674677 ROCK-II was activated in various lung cells of patients with idiopathic pulmonary fibrosis along with oxidative stress detected by 8-isoPGF2alpha elevation.
24668682 These results suggest that there is no association of the ROCK2 gene Thr431Asn polymorphism with the development of cardiac septal defects in pediatric patients.
24617500 This is the first study to examine the involvement of ROCK1 and ROCK2 gene variations in the risk of primary open-angle glaucoma development.
24615293 morgana causes PTEN destabilization, by inhibiting ROCK activity
24610576 Study reports a unique, PGE2-induced, functional inhibitory phosphoS1379 site on ROCK2 that mutational analysis con fi rms is critical to the activity of the enzyme in terms of myosin light chain II and paxillin phosphorylation, hence controlling the formation of stress fi bres and focal adhesions in fibroblast-myo fi broblast transitions.
24608447 ROCK2 gene Thr431Asn polymorphism is not a risk factor for migraine in the Turkish population.
24604753 Loss of TSC2 expression can alter microtubule organization and dynamics, which, in turn, deregulate cell division and potentially impair neuronal differentiation via ROCK2 signaling.
24170433 Selective knockdown of ROCK2 exerted antidromic effects on glioma migration.
24168723 Active ROCKI is phosphorylated at Ser1333 site. Antibodies that recognize phospho-Ser1333 of ROCKI and phospho-S1366 residues of ROCKII offer a means to discriminate their individual active status in cells and tissues.
24135024 ROCK2 in vascular smooth cells contributes to the pathogenesis of hypoxia-induced pulmonary arterial hypertension.
24065547 Testosterone induces actin cytoskeleton remodeling by regulating ROCK-2/moesin expression and activation.
24036111 CRMP-2-dependent regulation of ROCK II activity is mediated through interaction of the CRMP-2L N terminus with the ROCK II catalytic domain as well as by GSK3-dependent phosphorylation of CRMP-2.
23789633 Immunohistochemical and western blot analyses showed no change in ROCK1 and ROCK2 protein expressions in Barrett's esophagus
23644663 we have shown that forced expression of wild-type CD99 in osteosarcoma cells induces downregulation of genes such as ROCK2
23615712 Results suggest miR-126 function as a potential tumor suppressor in colon cancer progression and miR-126/RhoA/ROCK may be a novel candidate for developing rational therapeutic strategies.
23479079 Sulfide induces both ROCK-1 and ROCK-2 cleavage and causes ROCKdependent cell blebbing during apoptosis.
23328676 Our data showed that the ROCK1 and ROCK2 genes might be a risk factor for colorectal cancer development
23326532 The relationship between the ROCK2 polymorphisms and cardiovascular disease risk cannot be entirely discounted and warrants further evaluation in a large population.
23211630 These results suggest that ROCK2 might mediate bFGF-induced proliferation of SH-SY5Y cells through GSK-3beta and beta-catenin pathway
22986902 the two isoforms of Rho-kinase distribute differentially to accomplish their specific functions
22942252 suppression of ROCK1 or ROCK2 expression alone was sufficient to impair anchorage-independent growth, supporting their nonoverlapping roles in oncogenesis
22939913 The results strongly suggest that ROCK2 gene polymorphisms may modify individual susceptibility to Behcet's disease in the Turkish population.
22842919 Angiotensin II induces the contraction of airway smooth muscle cells; this effect can be reversed by Ang-(1-7), partially through the downregulation of of the RhoA/ROCK2 signaling pathway.
22798677 our overall results reveal a model whereby CD1d-mediated Ag presentation is negatively regulated by ROCK1 and ROCK2 via its effects on the actin cytoskeleton.
22705122 A new role for Rock2 in modulation of Cdc25A ubiquitination has been revealed, indicating a novel mechanism of Cdc25A regulation and a potential function for Rock2 in the development of hepatocellular carcinoma.
22462535 We conclude that ROCK proteins are necessary for acquisition of elongated and geometric cell shape, two key events for epithelial differentiation.
22348083 ROCK1 and ROCK2 have distinct and separate roles in adhesion complex assembly and turnover in human epidermal keratinocytes.
22273145 We found that the extent of Ser1366 phosphorylation of endogenous ROCKII is correlated with that of myosin light chain phosphorylation in cells in response to RhoA stimulation, showing that Ser1366 phosphorylation reflects its kinase activity
22262769 HIV-1 p17-mediated activation of the Rho/ROCK-signaling pathway is required for p17-mediated monocyte adhesion and migration
22241857 It was concluded that RhoA/ROCK is active in the internal anal sphincter (IAS), and is the critical determinant of the basal tone in intact human IAS and that they are potential therapeutic targets for a number of rectoanal motility disorders.
22232555 Results demonstrate differential effects of Snail and Slug in pancreatic cancer and identify the interplay between Rho signaling and beta1-integrin that regulates the scattering and migration of Snail- and Slug-expressing pancreatic cancer cells.
22155728 ROCK1 has a role in regulating myometrial contractility.
22093931 The up-regulated expression of ROCK2 is correlated with patient age and differentiation grade of esophageal squamous cell carcinoma.
22001410 A novel mechanism for controlling ROCKII localization at the membrane, in which the ROCKII C-terminus acts as a coincidence detector for spatial regulatory signals.
21423810 HIV-1 p17-mediated activation of the Rho/ROCK-signaling pathway is required for p17-mediated monocyte adhesion and migration
21303778 Ras/Raf/MAPK and RhoA/ROCKII signalling pathways are abnormally activated in eutopic endometrial stromal cells of patients with endometriosis
21147781 LR11 is phosphorylated in vivo and indicate that ROCK2 phosphorylation of LR11 may enhance LR11 mediated processing of APP and amyloid production.
21084279 results suggested that a complex consisting of BRCA2, NPM, and ROCK2 maintains the numerical integrity of centrosomes and accurate cell division and that dysfunction of this regulation might be involved in the tumorigenesis of breast cancer
20961215 The results of this study suggested that there were no evidence for an association of ROCK2 gene Thr431Asn and Arg83Lys polymorphisms with diabetes or diabetic retinopathy in the Turkish population.
20961215 Observational study of gene-disease association. (HuGE Navigator)
20951699 Expression of miR-139 is reduced in human metastatic hepatocellular carcinoma samples and correlates with prognosis. The microRNA miR-139 interacts with ROCK2 and reduces its expression in hepatocellular carcinoma.
20939434 Thr431Asn polymorphism of the ROCK2 gene could be a risk factor for the metastases of the breast cancer, and may help in predicting the prognosis.
20939434 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20504226 upregulated rho-associated protein kinase 2, p-cofilin and intracellular adhesion molecule-1, and downregulated E-cadherin were found in esophageal squamous cell cancer cells
20429915 Results suggest that VEGF-C promoted cervical cancer metastasis by upregulation and activation of moesin protein through RhoA/ROCK-2 pathway.
20346360 Observational study of gene-disease association. (HuGE Navigator)
20232393 results suggest that miR-138 plays an important role in TSCC cell migration and invasion by concurrently targeting RhoC and ROCK2, and miR-138 may serve as a novel therapeutic target for TSCC patients at risk of metastatic disease
20181930 A functional proteomics approach enabled the authors to identify novel LOX-1 interactors that potentially contribute to the cellular and signaling functions of LOX-1.
20164172 Pharmacologic inhibition of Rho kinase 2 signaling blocked LPA-induced p65 phosphorylation and suppressed ICAM-1 and VCAM-1 expression.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19997641 These data suggest that ROCK1 and ROCK2 play distinct roles in regulating keratinocyte adhesion and terminal differentiation.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19590140 Provide evidence for Rho-kinase activation in patients with pulmonary arterial hypertension.
19435756 Data conclude that common genetic variation in ROCK2 is unlikely to make a major contribution to the risk of pre-eclampsia, but cannot exclude the possibility of having missed non-coding functional variants or rare coding variants.
19422706 Stimulation of PKC disrupts epithelial apical junctions via ROCK-II dependent stimulation of actomyosin contractility.
19205033 overexpressed in hepatocellular carcinoma and played a significant role in regulating cytoskeletal events and contributed to the invasion of hepatocellular carcinoma
19181962 Inhibition of Rho-dependent kinases ROCK I/II activates VEGF-driven retinal neovascularization and sprouting angiogenesis.
19131646 ROCK1 and ROCK2 regulated myosin light chain phosphatase. ROCK isoforms had distinct and opposing effects on vascular smooth muscle cell (VSMC) morphology and ROCK2, but not ROCK1, had a predominant role in VSMC contractility.
19099536 ROCK2 activity and dimerization were dependent upon the interaction between Thr(405) of the hydrophobic motif and Asp(39) of the N-terminal extension. The reciprocal exchange of these residues was permissive for kinase activity, but not for dimerization.
18971541 a major haplotype block at the ROCK2 locus is recessively associated with a lower risk of hypertension
18971541 Observational study of gene-disease association. (HuGE Navigator)
18922892 a feedback loop between Rho/ROCK, Src, and phosphorylated Cav1 in tumor cell protrusions, identifying a novel function for Cav1 in tumor metastasis that may contribute to the poor prognosis of some Cav1-expressing tumors.
18695890 ROCKI and possibly ROCKII are key factors in regulation of motility/invasion of breast cancer cells
18668558 Rock potently stimulates the differentiation of resting fibroblasts into myofibroblasts and the production of extracellular matrix in scleroderma fibroblasts.
18496125 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18495812 Rock1 and 2 are activated in response to wounding. ROCK activities enhance cell proliferation and epithelial differentiation, but negatively modulate cell migration and adhesion and therefore play a role in regulating corneal epithelial wound healing.
18331468 Inhibition of ROCK activity in human-derived cells enhanced either bacterial adhesion or adhesion and entry in an InlF-independent manner, further suggesting a host species or cell type-specific role for InlF.
17596509 These findings demonstrate a central role of the GEF-H1/Rho/ROCK-II signaling pathway in the disassembly of apical junctional complex in epithelial cells.
17572668 HIV-1 p17-mediated activation of the Rho/ROCK-signaling pathway is required for p17-mediated monocyte adhesion and migration
17446864 Plk1 and RhoA function to enhance Rock2 kinase activity in vitro and within cells, and implicate Plk1 as a regulator of multiple pathways that synergistically converge to regulate actomyosin ring contraction during cleavage furrow ingression.
17344417 findings report that the Notch1 gene is a p53 target in human keratinocytes with a role in tumor suppression of this cell type through negative regulation of the ROCK1/2 and MRCKalpha kinases
17167780 Dual regulatory role for Rho kinase in fibroblast regulation in which lipid-induced Rho kinase activation suppresses fibroblast morphogenesis while TGF-beta1-induced Rho kinase activation culminates in transformation into myofibroblasts.
17012370 These results indicate that 2ME-induced barrier disruption is governed by microtubule depolymerization and p38- and ROCK-dependent mechanisms.
16996686 study investigated the role of RhoA and Rho-kinase in endothelial eNOS protein expression under hypoxic conditions
16585408 Common variation in ROCK2 exerts systemic resistance-mediated changes in blood pressure and is novel mechanism for human circulatory control and suggests new possibilities for diagnosis and treatment of subjects at risk of hypertension.
16531242 The crystal structure of an active Rho-kinase fragment containing the kinase domain revealed a head-to-head homodimer through the N-terminal extension forming a helix bundle that structurally integrates the C-terminal extension.
15699075 Data show that granzyme B directly cleaves ROCK II, and that this causes constitutive kinase activity and bleb formation.
15044207 results indicate that remnant-like particles from sudden cardiac death patients upregulate Rho-kinase in coronary vascular smooth muscle cells and markedly enhance coronary vasospastic activity
12482610 ROKalpha is regulated by CRMP-1 and CRMP2
12185584 diphosphorylated MRLC and Rho-kinase accumulated and colocalized at the contractile ring and the midbody in dividing cells
12176052 characterization and purification of human ROCK-II
12126956 ROCK-II-induced membrane blebbing and chromatin condensation require actin cytoskeleton. "ROCK-II"
12102637 kinetic mechanisms

AA Sequence

MSRPPPTGKMPGAPETAPGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDN      1 - 70
FLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEE     71 - 140
RDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGL    141 - 210
IHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSV    211 - 280
GVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQ    281 - 350
HPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENL    351 - 420
LLSDSPSCRETDSIQSRKNEESQEIQKKLYTLEEHLSNEMQAKEELEQKCKSVNTRLEKTAKELEEEITL    421 - 490
RKSVESALRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLKDQLEDLKKRNQNSQISTEKVNQL    491 - 560
QRQLDETNALLRTESDTAARLRKTQAESSKQIQQLESNNRDLQDKNCLLETAKLKLEKEFINLQSALESE    561 - 630
RRDRTHGSEIINDLQGRICGLEEDLKNGKILLAKVELEKRQLQERFTDLEKEKSNMEIDMTYQLKVIQQS    631 - 700
LEQEEAEHKATKARLADKNKIYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSLLDCDLKQ    701 - 770
SQQKINELLKQKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMN    771 - 840
LEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKTKLGKELQQKKQELQDERDS    841 - 910
LAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQELTEKDATIASLEETNRTLTS    911 - 980
DVANLANEKEELNNKLKDVQEQLSRLKDEEISAAAIKAQFEKQLLTERTLKTQAVNKLAEIMNRKEPVKR    981 - 1050
GNDTDVRRKEKENRKLHMELKSEREKLTQQMIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLR   1051 - 1120
SQLQALHIGLDSSSIGSGPGDAEADDGFPESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQD   1121 - 1190
KEQSNPYMVLDIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEQEFPVEPVGEKSNYICHKG   1191 - 1260
HEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISTAKNLLLL   1261 - 1330
ANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSRQLAPNKPS               1331 - 1388
//

Text Mined References (142)

PMID Year Title
26928204 2016 Uni-axial stretch induces actin stress fiber reorganization and activates c-Jun NH2 terminal kinase via RhoA and Rho kinase in human bladder smooth muscle cells.
26901778 2016 Rho Kinase ROCK2 Mediates Acid-Induced NADPH Oxidase NOX5-S Expression in Human Esophageal Adenocarcinoma Cells.
26826790 2016 Matrix rigidity differentially regulates invadopodia activity through ROCK1 and ROCK2.
26818518 2016 Rho Kinase Inhibition as a Therapeutic for Progressive Supranuclear Palsy and Corticobasal Degeneration.
26818475 2016 Polymorphisms and haplotype of ROCK2 associate with high altitude essential hypertension in native high altitude Ladakhi Indian population: a preliminary study.
26626121 2015 Immunohistochemical evaluation of ROCK activation in invasive breast cancer.
26620183 2015 A molecular ruler regulates cytoskeletal remodelling by the Rho kinases.
26572751 2016 Partial deletion of the ROCK2 protein fails to reduce renal fibrosis in a unilateral ureteral obstruction model in mice.
26505794 2015 Rock2 stabilizes ?-catenin to promote tumor invasion and metastasis in colorectal cancer.
26481340 2015 Role of Rho Kinase and Fasudil on Synaptic Plasticity in Multiple Sclerosis.
26468005 2015 Inverse relationship of Rho kinase and myosin-light chain kinase expression in the aging human detrusor smooth muscle.
26261605 2015 Expression of Wnt11 and Rock2 protein with clinical characteristics of esophageal squamous cell carcinoma in Kazakh and Han patients.
25969175 2015 Low Expression of miR-448 Induces EMT and Promotes Invasion by Regulating ROCK2 in Hepatocellular Carcinoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25940707 2015 17?-Estradiol Induces Overproliferation in Adenomyotic Human Uterine Smooth Muscle Cells of the Junctional Zone Through Hyperactivation of the Estrogen Receptor-Enhanced RhoA/ROCK Signaling Pathway.
25916120 [Ouabain induces Rho-dependent rock activation and membrane blebbing incultured endothelial cells].
25912304 2015 MicroRNA-144 suppresses osteosarcoma growth and metastasis by targeting ROCK1 and ROCK2.
25909223 2015 MiR-200b/200c/429 subfamily negatively regulates Rho/ROCK signaling pathway to suppress hepatocellular carcinoma metastasis.
25872785 2015 Inhibition of TMEM45A suppresses proliferation, induces cell cycle arrest and reduces cell invasion in human ovarian cancer cells.
25869521 2015 ROCK2 primes the endothelium for vascular hyperpermeability responses by raising baseline junctional tension.
25840982 2015 Rho kinase inhibitors block melanoma cell migration and inhibit metastasis.
25816133 2015 Tumor necrosis factor disrupts claudin-5 endothelial tight junction barriers in two distinct NF-?B-dependent phases.
25771860 2015 ROCK2 promotes HCC proliferation by CEBPD inhibition through phospho-GSK3?/?-catenin signaling.
25755711 2015 Overexpression of ROCK1 and ROCK2 inhibits human laryngeal squamous cell carcinoma.
25677806 2015 RhoC and ROCKs regulate cancer cell interactions with endothelial cells.
25577341 2015 The effect of ROCK on TNF-?-induced CXCL8 secretion by intestinal epithelial cell lines is mediated through MKK4 and JNK signaling.
25481646 2015 Two functional polymorphisms of ROCK2 enhance arterial stiffening through inhibiting its activity and expression.
25279428 2014 Advanced glycation end products activate the miRNA/RhoA/ROCK2 pathway in endothelial cells.
25251472 2014 Rock2 promotes the invasion and metastasis of hepatocellular carcinoma by modifying MMP2 ubiquitination and degradation.
25011614 2014 Caffeine inhibits migration in glioma cells through the ROCK-FAK pathway.
24674677 ROCK activation in lung of idiopathic pulmonary fibrosis with oxidative stress.
24668682 2014 Is there any association between childhood cardiac septal defects and ROCK2 gene polymorphism?
24617500 2016 Investigation of the Rho-kinase Gene Polymorphism in Primary Open-angle Glaucoma.
24615293 2014 Morgana acts as a proto-oncogene through inhibition of a ROCK-PTEN pathway.
24610576 2014 Prostaglandin E(2)-dependent blockade of actomyosin and stress fibre formation is mediated through S1379 phosphorylation of ROCK2.
24608447 Investigation of the Rho-kinase 2 gene Thr431Asn polymorphism in migraine.
24604753 2014 Tubers from patients with tuberous sclerosis complex are characterized by changes in microtubule biology through ROCK2 signalling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24170433 2014 Opposing signaling of ROCK1 and ROCK2 determines the switching of substrate specificity and the mode of migration of glioblastoma cells.
24168723 2013 Ser1333 phosphorylation indicates ROCKI activation.
24135024 2013 Crucial role of ROCK2 in vascular smooth muscle cells for hypoxia-induced pulmonary hypertension in mice.
24065547 2013 Testosterone promotes vascular endothelial cell migration via upregulation of ROCK-2/moesin cascade.
24036111 2013 Phosphorylation and mRNA splicing of collapsin response mediator protein-2 determine inhibition of rho-associated protein kinase (ROCK) II function in carcinoma cell migration and invasion.
23789633 2013 Investigation of the esophageal Rho-kinase expression in patients with Barrett's esophagus.
23644663 2014 CD99 suppresses osteosarcoma cell migration through inhibition of ROCK2 activity.
23615712 2013 MiR-126 suppresses colon cancer cell proliferation and invasion via inhibiting RhoA/ROCK signaling pathway.
23479079 2013 Sulfide induces apoptosis and Rho kinase-dependent cell blebbing in Jurkat cells.
23328676 2013 Role of rho-kinase gene polymorphisms and protein expressions in colorectal cancer development.
23326532 2013 Association analysis of polymorphisms in ROCK2 with cardiovascular disease in a Chinese population.
23211630 2013 ROCK2 regulates bFGF-induced proliferation of SH-SY5Y cells through GSK-3? and ?-catenin pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22986902 2012 Distinct distribution and localization of Rho-kinase in mouse epithelial, muscle and neural tissues.
22942252 2012 ROCK1 and ROCK2 are required for non-small cell lung cancer anchorage-independent growth and invasion.
22939913 2012 Association between Rho-kinase (ROCK2) gene polymorphisms and Behçet's disease.
22842919 2012 Inhibition of angiotensin II-induced contraction of human airway smooth muscle cells by angiotensin-(1-7) via downregulation of the RhoA/ROCK2 signaling pathway.
22798677 2012 Regulation of the actin cytoskeleton by Rho kinase controls antigen presentation by CD1d.
22705122 2012 Rock2 regulates Cdc25A through ubiquitin proteasome system in hepatocellular carcinoma cells.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22462535 2012 ROCK1 and ROCK2 regulate epithelial polarisation and geometric cell shape.
22348083 2012 Differential regulation of adhesion complex turnover by ROCK1 and ROCK2.
22273145 2012 ROCKII Ser1366 phosphorylation reflects the activation status.
22241857 2012 RhoA/ROCK pathway is the major molecular determinant of basal tone in intact human internal anal sphincter.
22232555 2012 Interplay between ?1-integrin and Rho signaling regulates differential scattering and motility of pancreatic cancer cells by snail and Slug proteins.
22155728 2012 Phasic contractions of isolated human myometrium are associated with Rho-kinase (ROCK)-dependent phosphorylation of myosin phosphatase-targeting subunit (MYPT1).
22093931 2011 [Relationship between ROCK2 expression and clinicopathologic characteristics of esophageal squamous cell carcinoma].
22001410 2011 Regulation of ROCKII membrane localization through its C-terminus.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21303778 2011 Abnormal activation of Ras/Raf/MAPK and RhoA/ROCKII signalling pathways in eutopic endometrial stromal cells of patients with endometriosis.
21269460 2011 Initial characterization of the human central proteome.
21147781 2011 Rho kinase II phosphorylation of the lipoprotein receptor LR11/SORLA alters amyloid-beta production.
21084279 2011 BRCA2 and nucleophosmin coregulate centrosome amplification and form a complex with the Rho effector kinase ROCK2.
20961215 2010 Lack of association between the Thr431Asn and Arg83Lys polymorphisms of the ROCK2 gene and diabetic retinopathy.
20951699 2011 The microRNA miR-139 suppresses metastasis and progression of hepatocellular carcinoma by down-regulating Rho-kinase 2.
20939434 2010 Association between the Thr431Asn polymorphism of the ROCK2 gene and risk of developing metastases of breast cancer.
20826462 2010 Src-dependent phosphorylation of ROCK participates in regulation of focal adhesion dynamics.
20803696 2010 Rho-kinase/ROCK: A key regulator of the cytoskeleton and cell polarity.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20504226 2010 Autocrine motility factor receptor signaling pathway promotes cell invasion via activation of ROCK-2 in esophageal squamous cell cancer cells.
20429915 2010 Vascular endothelial growth factor C promotes cervical cancer metastasis via up-regulation and activation of RhoA/ROCK-2/moesin cascade.
20346360 2010 Genetic risk factors for hepatopulmonary syndrome in patients with advanced liver disease.
20232393 2010 Downregulation of the Rho GTPase signaling pathway is involved in the microRNA-138-mediated inhibition of cell migration and invasion in tongue squamous cell carcinoma.
20230755 2010 Morgana/chp-1, a ROCK inhibitor involved in centrosome duplication and tumorigenesis.
20181930 2010 ROCK2 associates with lectin-like oxidized LDL receptor-1 and mediates oxidized LDL-induced IL-8 production.
20164172 2010 Rho kinase-2 activation in human endothelial cells drives lysophosphatidic acid-mediated expression of cell adhesion molecules via NF-kappaB p65.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19997641 2009 Distinct roles for ROCK1 and ROCK2 in the regulation of keratinocyte differentiation.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19590140 2009 Evidence for Rho-kinase activation in patients with pulmonary arterial hypertension.
19435756 2009 ROCK2 allelic variants are not associated with pre-eclampsia susceptibility in the Finnish population.
19422706 2009 Protein kinase C activation disrupts epithelial apical junctions via ROCK-II dependent stimulation of actomyosin contractility.
19376974 2009 Roles for endocytic trafficking and phosphatidylinositol 4-kinase III alpha in hepatitis C virus replication.
19205033 2009 Rho-kinase 2 is frequently overexpressed in hepatocellular carcinoma and involved in tumor invasion.
19181962 2009 Inhibition of Rho-dependent kinases ROCK I/II activates VEGF-driven retinal neovascularization and sprouting angiogenesis.
19131646 2009 ROCK isoform regulation of myosin phosphatase and contractility in vascular smooth muscle cells.
19099536 2009 The hydrophobic motif of ROCK2 requires association with the N-terminal extension for kinase activity.
18971541 2008 A major haplotype block at the rho-associated kinase 2 locus is associated with a lower risk of hypertension in a recessive manner: the HYPGENE study.
18922892 2008 Phosphorylated caveolin-1 regulates Rho/ROCK-dependent focal adhesion dynamics and tumor cell migration and invasion.
18695890 2008 The expression and prognostic value of ROCK I and ROCK II and their role in human breast cancer.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18668558 2008 Rho-associated kinases are crucial for myofibroblast differentiation and production of extracellular matrix in scleroderma fibroblasts.
18559669 2008 Regulation of RhoA-dependent ROCKII activation by Shp2.
18496125 2008 Interactions among genetic variants from contractile pathway of vascular smooth muscle cell in essential hypertension susceptibility of Chinese Han population.
18495812 2008 Rho kinases regulate corneal epithelial wound healing.
18331468 2008 Inhibition of ROCK activity allows InlF-mediated invasion and increased virulence of Listeria monocytogenes.
17596509 2007 Rho/Rho-associated kinase-II signaling mediates disassembly of epithelial apical junctions.
17446864 2007 Proteomic screen defines the Polo-box domain interactome and identifies Rock2 as a Plk1 substrate.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17344417 2007 Notch1 is a p53 target gene involved in human keratinocyte tumor suppression through negative regulation of ROCK1/2 and MRCKalpha kinases.
17167780 2007 Diverse signaling pathways regulate fibroblast differentiation and transformation through Rho kinase activation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17015463 2006 Interaction between ROCK II and nucleophosmin/B23 in the regulation of centrosome duplication.
17012370 2007 Involvement of microtubules, p38, and Rho kinases pathway in 2-methoxyestradiol-induced lung vascular barrier dysfunction.
16996686 2006 Hypoxia-induced upregulation of endothelial small G protein RhoA and Rho-kinase/ROCK2 inhibits eNOS expression.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16585408 2006 Rho kinase polymorphism influences blood pressure and systemic vascular resistance in human twins: role of heredity.
16574662 2006 Nuclear Rho kinase, ROCK2, targets p300 acetyltransferase.
16531242 2006 Molecular mechanism for the regulation of rho-kinase by dimerization and its inhibition by fasudil.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15699075 2005 Direct cleavage of ROCK II by granzyme B induces target cell membrane blebbing in a caspase-independent manner.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15121898 2004 The composition of Staufen-containing RNA granules from human cells indicates their role in the regulated transport and translation of messenger RNAs.
15044207 2004 Remnant lipoproteins from patients with sudden cardiac death enhance coronary vasospastic activity through upregulation of Rho-kinase.
12778124 2003 Rocks: multifunctional kinases in cell behaviour.
12600888 2003 Activation of RhoA and inhibition of myosin phosphatase as important components in hypertension in vascular smooth muscle.
12482610 2002 p80 ROKalpha binding protein is a novel splice variant of CRMP-1 which associates with CRMP-2 and modulates RhoA-induced neuronal morphology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12185584 2002 Rho-kinase contributes to diphosphorylation of myosin II regulatory light chain in nonmuscle cells.
12176052 2002 Characterization and purification of truncated human Rho-kinase II expressed in Sf-21 cells.
12126956 2002 ROCK-II-induced membrane blebbing and chromatin condensation require actin cytoskeleton.
12102637 2002 Kinetic mechanism for human Rho-Kinase II (ROCK-II).
11931630 2002 Integrin-linked kinase phosphorylates the myosin phosphatase target subunit at the inhibitory site in platelet cytoskeleton.
10601309 1999 Inhibitory phosphorylation site for Rho-associated kinase on smooth muscle myosin phosphatase.
10579722 1999 Phosphorylation of myosin-binding subunit (MBS) of myosin phosphatase by Rho-kinase in vivo.
10209029 1999 Phosphorylation of adducin by Rho-kinase plays a crucial role in cell motility.
9933571 1999 Localization of the gene coding for ROCK II/Rho kinase on human chromosome 2p24.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9463375 1998 In mouse brain profilin I and profilin II associate with regulators of the endocytic pathway and actin assembly.
8617235 1996 The small GTP-binding protein Rho binds to and activates a 160 kDa Ser/Thr protein kinase homologous to myotonic dystrophy kinase.