Property Summary

NCBI Gene PubMed Count 39
PubMed Score 68.80
PubTator Score 33.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
interstitial lung disease 1.900 2.3e-02
posterior fossa group A ependymoma -2.300 8.1e-07
oligodendroglioma -1.300 3.8e-03
osteosarcoma 1.686 2.9e-02
glioblastoma -2.100 3.2e-03
atypical teratoid / rhabdoid tumor -2.200 7.6e-05
medulloblastoma, large-cell -2.100 1.1e-02
non-small cell lung cancer -1.554 5.4e-14
lung adenocarcinoma -1.900 2.1e-15
pediatric high grade glioma -1.400 1.3e-02
group 4 medulloblastoma -3.500 1.1e-07
pilocytic astrocytoma -3.400 2.2e-06
lung carcinoma -2.300 3.1e-19
pituitary cancer -1.500 1.4e-05
head and neck cancer -2.500 1.0e-02
facioscapulohumeral dystrophy 1.900 4.9e-02

Protein-protein Interaction (1)

Gene RIF (23)

PMID Text
26608094 ROBO2 somatic mutation is associated with myelodysplastic syndrome progression. Overexpression of ROBO2 produces anti-proliferative and pro-apoptotic effects in leukemia cells. This effect was lost in ROBO mutants and ROBO-SLIT2 signaling is impaired.
26542734 Overexpression of ROBO2 induces its tumor suppressive effects in Breast cancer
26026792 Mutations of the SLIT2-ROBO2 pathway genes SLIT2 and SRGAP1 confer risk for congenital anomalies of the kidney and urinary tract
25226531 Common variation near ROBO2 is associated with expressive vocabulary in infancy.
24272677 Down-regulation of ROBO2 expression is associated with prostate cancers.
24247621 Frameshift mutations of ROBO1 and ROBO2 genes and alteration of ROBO2 expression in gastric and colorectal cancers suggest that both genes might play roles in the pathogenesis of both cancers.
23982283 The finding that a polymorphism associated with the ROBO2 gene, which is involved in neurodevelopment, confers risk for the common emotionally reactive, impulsive aspects of conduct disorder, independent of concurrent risk for psychopathy.
23536131 Results not completely rule out that some ROBO2 variants may be the sole cause of vesicoureteric reflux, but it is clear from the overall frequency that most of them cannot be.
22719878 data suggests the importance of abrogation of SLIT2-ROBO1 and SLIT2-ROBO2 interactions in the initiation and progression of CACX and also for early diagnosis and prognosis of the disease
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20345837 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20029409 Observational study of gene-disease association. (HuGE Navigator)
19959718 Observational study of gene-disease association. (HuGE Navigator)
19350278 gene variants in ROBO2 are rare causes of VUR in humans. Our results provide further evidence for the genetic heterogeneity of this disorder
19350278 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
19023125 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18270976 mRNA expression of ROBO2 in lymphocytes was significantly reduced in the autistic group
18235093 a relatively high frequency of ROBO2 variants (5.1%) was found in familial vesicoureteral reflux
18235093 Observational study of gene-disease association. (HuGE Navigator)
17357069 Disruption of ROBO2 is associated with urinary tract anomalies and confers risk of vesicoureteral reflux.
16829019 two differentially expressed isoforms were isolated and identified. Exons 1 and 2 of human ROBO2a lie in an inherently unstable DNA segment at human chromosome 3p12.3.

AA Sequence

MSLLMFTQLLLCGFLYVRVDGSRLRQEDFPPRIVEHPSDVIVSKGEPTTLNCKAEGRPTPTIEWYKDGER      1 - 70
VETDKDDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAVSRNASLEVALLRDDFRQNPT     71 - 140
DVVVAAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEERISIRGGKLMISNTRKSDAGMYTCVGTNMVG    141 - 210
ERDSDPAELTVFERPTFLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKDDADLPRGRYDIKDDYTLRI    211 - 280
KKTMSTDEGTYMCIAENRVGKMEASATLTVRAPPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKE    281 - 350
GSQNLLFPNQPQQPNSRCSVSPTGDLTITNIQRSDAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPII    351 - 420
LQGPANQTLAVDGTALLKCKATGDPLPVISWLKEGFTFPGRDPRATIQEQGTLQIKNLRISDTGTYTCVA    421 - 490
TSSSGETSWSAVLDVTESGATISKNYDLSDLPGPPSKPQVTDVTKNSVTLSWQPGTPGTLPASAYIIEAF    491 - 560
SQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRTQDISPPAQGVDHRQV    561 - 630
QKELGDVLVRLHNPVVLTPTTVQVTWTVDRQPQFIQGYRVMYRQTSGLQATSSWQNLDAKVPTERSAVLV    631 - 700
NLKKGVTYEIKVRPYFNEFQGMDSESKTVRTTEEAPSAPPQSVTVLTVGSYNSTSISVSWDPPPPDHQNG    701 - 770
IIQEYKIWCLGNETRFHINKTVDAAIRSVIIGGLFPGIQYRVEVAASTSAGVGVKSEPQPIIIGRRNEVV    771 - 840
ITENNNSITEQITDVVKQPAFIAGIGGACWVILMGFSIWLYWRRKKRKGLSNYAVTFQRGDGGLMSNGSR    841 - 910
PGLLNAGDPSYPWLADSWPATSLPVNNSNSGPNEIGNFGRGDVLPPVPGQGDKTATMLSDGAIYSSIDFT    911 - 980
TKTSYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSIQQKTDLMGFGYSLPDQNKGNNGGKGG    981 - 1050
KKKKNKNSSKPQKNNGSTWANVPLPPPPVQPLPGTELEHYAVEQQENGYDSDSWCPPLPVQTYLHQGLED   1051 - 1120
ELEEDDDRVPTPPVRGVASSPAISFGQQSTATLTPSPREEMQPMLQAHLDELTRAYQFDIAKQTWHIQSN   1121 - 1190
NQPPQPPVPPLGYVSGALISDLETDVADDDADDEEEALEIPRPLRALDQTPGSSMDNLDSSVTGKAFTSS   1191 - 1260
QRPRPTSPFSTDSNTSAALSQSQRPRPTKKHKGGRMDQQPALPHRREGMTDEEALVPYSKPSFPSPGGHS   1261 - 1330
SSGTASSKGSTGPRKTEVLRAGHQRNASDLLDIGYMGSNSQGQFTGEL                         1331 - 1378
//

Text Mined References (41)

PMID Year Title
26608094 2015 Whole-exome and targeted sequencing identify ROBO1 and ROBO2 mutations as progression-related drivers in myelodysplastic syndromes.
26542734 2015 Function of Slit/Robo signaling in breast cancer.
26026792 2015 Mutations of the SLIT2-ROBO2 pathway genes SLIT2 and SRGAP1 confer risk for congenital anomalies of the kidney and urinary tract.
25226531 2014 Common variation near ROBO2 is associated with expressive vocabulary in infancy.
24272677 2014 Down-regulation of ROBO2 expression in prostate cancers.
24247621 2013 Frameshift mutations of axon guidance genes ROBO1 and ROBO2 in gastric and colorectal cancers with microsatellite instability.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23982283 2013 Replication of a ROBO2 polymorphism associated with conduct problems but not psychopathic tendencies in children.
23568457 2013 Genetic variants associated with disordered eating.
23536131 2013 Heterozygous non-synonymous ROBO2 variants are unlikely to be sufficient to cause familial vesicoureteric reflux.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
22719878 2012 Inactivation of SLIT2-ROBO1/2 pathway in premalignant lesions of uterine cervix: clinical and prognostic significances.
22675492 2012 Genome-wide association study of circulating estradiol, testosterone, and sex hormone-binding globulin in postmenopausal women.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20345837 2010 In search of genes associated with risk for psychopathic tendencies in children: a two-stage genome-wide association study of pooled DNA.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20029409 2010 Association of polymorphisms in the SLIT2 axonal guidance gene with anger in suicide attempters.
19959718 2010 Whole-genome linkage and association scan in primary, nonsyndromic vesicoureteric reflux.
19350278 2009 Mutations in the ROBO2 and SLIT2 genes are rare causes of familial vesico-ureteral reflux.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19023125 2009 A genome-wide association study of schizophrenia using brain activation as a quantitative phenotype.
18566128 2008 Novel regulated expression of the SLIT/ROBO pathway in the ovary: possible role during luteolysis in women.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
18270976 2008 Genetic analyses of roundabout (ROBO) axon guidance receptors in autism.
18235093 2008 ROBO2 gene variants are associated with familial vesicoureteral reflux.
17357069 2007 Disruption of ROBO2 is associated with urinary tract anomalies and confers risk of vesicoureteral reflux.
16829019 2006 Isolation and differential expression of two isoforms of the ROBO2/Robo2 axon guidance receptor gene in humans and mice.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15207848 2004 Extracellular Ig domains 1 and 2 of Robo are important for ligand (Slit) binding.
15130495 2004 SLIT2-mediated ROBO2 signaling restricts kidney induction to a single site.
12504588 2002 Robo1 and Robo2 are homophilic binding molecules that promote axonal growth.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11748139 2001 Slit proteins are not dominant chemorepellents for olfactory tract and spinal motor axons.
11404413 2001 Diversity and specificity of actions of Slit2 proteolytic fragments in axon guidance.
10997877 2000 Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10197527 1999 Slit2-Mediated chemorepulsion and collapse of developing forebrain axons.
10102268 1999 Slit proteins bind Robo receptors and have an evolutionarily conserved role in repulsive axon guidance.
9458045 1998 Roundabout controls axon crossing of the CNS midline and defines a novel subfamily of evolutionarily conserved guidance receptors.