Property Summary

NCBI Gene PubMed Count 45
PubMed Score 22.28
PubTator Score 53.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (6)

PMID Text
21508110 SRBD1 gene polymorphism is associated with the development of HTG as well as NTG, including late-onset NTG.
18854154 Knockdown of RNA binding protein S1, serine-rich domain (RNPS1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
17959926 RNPS1 is able to function together with ASF/SF2 to form ribonucleoprotein complexes on nascent transcripts, and thereby prevent formation of transcriptional R-loops.
15684395 The phosphorylation of RNPS1 at Ser-53 influences the efficiencies of both splicing and translation.
11546874 has a role in mRNA surveillance (detecting mRNAs with truncated open reading frames and subjecting them to nonsense-mediated mRNA decay (NMD))
11546873 binds to Upf complexes which bind upstream of mRNA exon-exon junctions

AA Sequence

MDLSGVKKKSLLGVKENNKKSSTRAPSPTKRKDRSDEKSKDRSKDKGATKESSEKDRGRDKTRKRRSASS      1 - 70
GSSSTRSRSSSTSSSGSSTSTGSSSGSSSSSASSRSGSSSTSRSSSSSSSSGSPSPSRRRHDNRRRSRSK     71 - 140
SKPPKRDEKERKRRSPSPKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEF    141 - 210
ENPDEAEKALKHMDGGQIDGQEITATAVLAPWPRPPPRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRR    211 - 280
SPVRRRSRSPGRRRHRSRSSSNSSR                                                 281 - 305
//

Text Mined References (53)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25920683 2015 Inherited and Somatic Defects in DDX41 in Myeloid Neoplasms.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23084401 2012 The cellular EJC interactome reveals higher-order mRNP structure and an EJC-SR protein nexus.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22388736 2012 The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22203037 2012 Proteins associated with the exon junction complex also control the alternative splicing of apoptotic regulators.
21508110 2011 Association between SRBD1 and ELOVL5 gene polymorphisms and primary open-angle glaucoma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20966198 2010 Human SAP18 mediates assembly of a splicing regulatory multiprotein complex via its ubiquitin-like fold.
20857263 2010 Novel cis-active structures in the coding region mediate CRM1-dependent nuclear export of IFN-? 1 mRNA.
20123736 2010 TRAP150 activates pre-mRNA splicing and promotes nuclear mRNA degradation.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19403727 2009 Two alternatively spliced isoforms of the Arabidopsis SR45 protein have distinct roles during normal plant development.
19324961 2009 Assembly and mobility of exon-exon junction complexes in living cells.
17959926 2007 The RNA binding protein RNPS1 alleviates ASF/SF2 depletion-induced genomic instability.
17586820 2007 The abundance of RNPS1, a protein component of the exon junction complex, can determine the variability in efficiency of the Nonsense Mediated Decay pathway.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16314458 2005 Biochemical analysis of the EJC reveals two new factors and a stable tetrameric protein core.
16209946 2005 Exon-junction complex components specify distinct routes of nonsense-mediated mRNA decay with differential cofactor requirements.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15684395 2005 Activation of pre-mRNA splicing by human RNPS1 is regulated by CK2 phosphorylation.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14752011 2004 Splicing enhances translation in mammalian cells: an additional function of the exon junction complex.
14729963 2004 Human RNPS1 and its associated factors: a versatile alternative pre-mRNA splicing regulator in vivo.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14625303 2004 A simple whole cell lysate system for in vitro splicing reveals a stepwise assembly of the exon-exon junction complex.
14517304 2003 Nuclear Pnn/DRS protein binds to spliced mRNPs and participates in mRNA processing and export via interaction with RNPS1.
12944400 2003 An evolutionarily conserved role for SRm160 in 3'-end processing that functions independently of exon junction complex formation.
12665594 2003 ASAP, a novel protein complex involved in RNA processing and apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
12093754 2002 The exon junction complex is detected on CBP80-bound but not eIF4E-bound mRNA in mammalian cells: dynamics of mRNP remodeling.
11546874 2001 Communication of the position of exon-exon junctions to the mRNA surveillance machinery by the protein RNPS1.
11546873 2001 Role of the nonsense-mediated decay factor hUpf3 in the splicing-dependent exon-exon junction complex.
11477570 2001 Binding of a SART3 tumor-rejection antigen to a pre-mRNA splicing factor RNPS1: a possible regulation of splicing by a complex formation.
11118221 2000 The spliceosome deposits multiple proteins 20-24 nucleotides upstream of mRNA exon-exon junctions.
10449421 1999 Purification and characterization of human RNPS1: a general activator of pre-mRNA splicing.
9933612 1999 The nuclear cap-binding complex is a novel target of growth factor receptor-coupled signal transduction.
9580558 1998 The RNP protein, RNPS1, associates with specific isoforms of the p34cdc2-related PITSLRE protein kinase in vivo.
8828041 1996 Generation of a transcriptional map for a 700-kb region surrounding the polycystic kidney disease type 1 (PKD1) and tuberous sclerosis type 2 (TSC2) disease genes on human chromosome 16p3.3.
8543184 1995 Identification and characterisation of a novel human RNA-binding protein.