Property Summary

NCBI Gene PubMed Count 22
PubMed Score 78.96
PubTator Score 20.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.100 4.7e-06
medulloblastoma, large-cell 1.200 7.9e-04
group 4 medulloblastoma 1.200 5.7e-05
spina bifida -1.632 4.0e-02
ovarian cancer 1.100 7.1e-05

 MGI Phenotype (1)

Protein-protein Interaction (9)

Gene RIF (7)

PMID Text
26942677 CDK1-Cyclin B1 activates RNMT, coordinating mRNA cap methylation with G1 phase transcription.
24763612 High RNMT expression is associated with liver cancer.
24200467 Data suggest the C-terminal nuclear localization domain (QYP) is critical for RAM (RNMT-activating mini protein) to enter the cell nucleus where RAM activates RNMT resulting in mRNA cap methylation. TNPO1/TNPO2 mediate RAM nuclear entry.
23863084 The RNMT N-terminal domain is required for transcript expression, translation and cell proliferation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19161160 Observational study of gene-disease association. (HuGE Navigator)
15767670 Nuclear localization of cap methyltransferase is mediated by alternative nuclear localization signal motifs

AA Sequence

MANSAKAEEYEKMSLEQAKASVNSETESSFNINENTTASGTGLSEKTSVCRQVDIARKRKEFEDDLVKES      1 - 70
SSCGKDTPSKKRKLDPEIVPEEKDCGDAEGNSKKRKRETEDVPKDKSSTGDGTQNKRKIALEDVPEKQKN     71 - 140
LEEGHSSTVAAHYNELQEVGLEKRSQSRIFYLRNFNNWMKSVLIGEFLEKVRQKKKRDITVLDLGCGKGG    141 - 210
DLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDI    211 - 280
CSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGD    281 - 350
YPLFGCKYDFNLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEP    351 - 420
YPANESSKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ                  421 - 476
//

Text Mined References (23)

PMID Year Title
26942677 2016 CDK1-Cyclin B1 Activates RNMT, Coordinating mRNA Cap Methylation with G1 Phase Transcription.
24763612 2014 Genome-wide study of hypomethylated and induced genes in patients with liver cancer unravels novel anticancer targets.
24200467 2014 RAM function is dependent on Kap?2-mediated nuclear entry.
23863084 2013 Human cap methyltransferase (RNMT) N-terminal non-catalytic domain mediates recruitment to transcription initiation sites.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
22099306 2011 RAM/Fam103a1 is required for mRNA cap methylation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19161160 2009 An association study of 45 folate-related genes in spina bifida: Involvement of cubilin (CUBN) and tRNA aspartic acid methyltransferase 1 (TRDMT1).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15767670 2005 Human mRNA cap methyltransferase: alternative nuclear localization signal motifs ensure nuclear localization required for viability.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11114884 2000 Cap methyltransferase selective binding and methylation of GpppG-RNA are stimulated by importin-alpha.
10589710 1999 The Candida albicans gene for mRNA 5-cap methyltransferase: identification of additional residues essential for catalysis.
10347220 1999 Characterization of human, Schizosaccharomyces pombe, and Candida albicans mRNA cap methyltransferases and complete replacement of the yeast capping apparatus by mammalian enzymes.
9828141 1998 Human mRNA capping enzyme (RNGTT) and cap methyltransferase (RNMT) map to 6q16 and 18p11.22-p11.23, respectively.
9790902 1998 Cloning and characterization of three human cDNAs encoding mRNA (guanine-7-)-methyltransferase, an mRNA cap methylase.
9705270 1998 Recombinant human mRNA cap methyltransferase binds capping enzyme/RNA polymerase IIo complexes.
9512541 1998 Isolation and characterization of a human cDNA for mRNA 5'-capping enzyme.
9455477 1997 Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro.
7275966 1981 Post-transcriptional modifications of mRNA. Purification and characterization of cap I and cap II RNA (nucleoside-2'-)-methyltransferases from HeLa cells.