Property Summary

NCBI Gene PubMed Count 19
PubMed Score 287.13
PubTator Score 63.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.700 1.5e-02
atypical teratoid / rhabdoid tumor 1.400 3.4e-08
ependymoma 2.300 1.2e-02
glioblastoma 1.300 2.7e-05
group 4 medulloblastoma 1.600 3.7e-04
medulloblastoma, large-cell 2.000 1.7e-05
oligodendroglioma 1.900 1.1e-02
osteosarcoma 1.275 8.2e-03
primitive neuroectodermal tumor 1.100 2.4e-05
psoriasis -2.000 2.8e-04
Waldenstrons macroglobulinemia -1.057 3.2e-02

Protein-protein Interaction (2)

Gene RIF (8)

AA Sequence

MAHNKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKVKMGLLVDLTNT      1 - 70
SRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNERNPPELIGVHCTHGFNRTGFLICAF     71 - 140
LVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDIEEAPPPPLLPDWCFEDDEDEDEDEDGKKES    141 - 210
EPGSSASFGKRRKERLKLGAIFLEGVTVKGVTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQN    211 - 280
IKLLDLKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDR    281 - 350
VNGQAVPRYLIYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRNKPFFDICT    351 - 420
SRKLLEGNFAKEVSHEMDGLIFQPTGKYKPGRCDDILKWKPPSLNSVDFRLKITRMGGEGLLPQNVGLLY    421 - 490
VGGYERPFAQIKVTKELKQYDNKIIECKFENNSWVFMRQRTDKSFPNAYNTAMAVCNSISNPVTKEMLFE    491 - 560
FIDRCTAASQGQKRKHHLDPDTELMPPPPPKRPRPLT                                     561 - 597
//

Text Mined References (22)

PMID Year Title