Property Summary

NCBI Gene PubMed Count 70
PubMed Score 64.03
PubTator Score 16.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (49)

PMID Text
26734725 The interaction of MDC1 with RNF8, but not with ATM requires WRAP53beta, suggesting that WRAP53beta facilitates the former interaction without altering phosphorylation of MDC1 by ATM.
26507658 These findings elucidate deeply and extensively the mechanism of RNF8/RNF168 and USP11 to maintain the proper status of ubiquitylation gammaH2AX to repair double strand breaks.
26381412 define a novel function for ATDC in the RNF8-mediated DNA damage response and implicate RNF8 binding as a key determinant of the radioprotective function of ATDC
25955491 Results indicate that RNF8 recruits and ubiquitinates many factors to repair DNA damage thereby conferring radioresistance to nasopharyngeal cancer cells.
25483088 our results indicate that down-regulation of RNF8 mediated by miR-214 impedes DNA damage response to induce chromosomal instability in ovarian cancers, which may facilitate the understanding of mechanisms underlying chromosomal instability.
25417706 Significantly restored tolerance of RAD18-/- and RNF8-/- cells to camptothecin and olaparib without affecting Rad51 focus formation.
25374327 considered potential associations of 14 single nucleotide polymorphisms (SNPs) in RNF8 and BRDT genes in Chinese patients with non-obstructive azoospermia
25337968 Depletion of RNF8 or RNF168 blocks the degradation of diffusely localized nuclear 53BP1.
25304081 Finding that RNF8 is less abundant than RNF168 identifies RNF8 as a rate-limiting determinant of focal repair complex assembly.
23615962 findings implicate USP44 in negative regulation of the RNF8/RNF168 pathway
23442799 RNF8 maintains genome stability through independent, yet analogous, nuclear and cytoplasmic ubiquitylation activities
23233665 The identification of RNF8 allows new insights into the integration of the control of p12 degradation by different DNA damage signaling pathways.
23230272 The PARP1-dependent localization of BAL1-BBAP functionally limits both early and delayed DNA damage and enhances cellular viability independent of ATM, MDC1, and RNF8.
23115235 Nbs1 is one important target of RNF8 to regulate DNA DSB repair.
23038782 PALB2 localization depends on the presence of MDC1, RNF8, RAP80 and Abraxas upstream of BRCA1.
22865450 Data indicate that RNF8-dependent chromatin ubiquitination is required for RAD51 assembly in BRCA1/53BP1-depleted cells.
22814251 RNF8 may play a role in protein synthesis, possibly linking the nucleolar exit of this factor to the attenuation of protein synthesis in response to DNA damage.
22705371 Data indicate that RNF8 and FAAP20 (C1orf86) are needed for efficient Fanconi anemia group D2 protein FANCD2 monoubiquitination.
22589545 Data show RING finger (RNF) E3 ubiquitin ligase RNF8 dimerizes and binds to E2 ubiquitin-conjugating complex Ubc13/Mms2 with formation of Lys-63 ubiquitin chains, whereas the RNF168 RING domain is a monomer and does not catalyze Lys-6 ubiquitylation.
22531782 A new mechanism of chromatin remodelling-assisted ubiquitylation was shown, which involves cooperation between CHD4 and RNF8 to create a local chromatin environment permissive to the assembly of checkpoint and repair machineries at DNA lesions.
22508508 In response to double-strand breaks, both HERC2 and RNF168 were specifically modified with SUMO1 at double-strand break sites in a manner dependent on the SUMO E3 ligase PIAS4.
22405594 By mimicking a cellular phosphosite, ICP0 binds RNF8 via the RNF8 forkhead associated (FHA) domain. Phosphorylation of ICP0 T67 by CK1 recruits RNF8 for degradation and thereby promotes viral transcription
22373579 The authors propose that the RNF8-dependent degradation of JMJD2A regulates DNA repair by controlling the recruitment of 53BP1 at DNA damage sites.
22266820 The authors find that RNF8 regulates the abundance of the nonhomologous end-joining (NHEJ) repair protein KU80 at sites of DNA damage.
21857671 Data show that depletion of RNF8, as well as of the E3 ligase RNF168, reduces telomere-induced genome instability.
21774837 entire coding region and splice junctions of RNF8, UBC13 and MMS2 genes were screened for mutations in affected index cases from 123 Northern Finnish breast cancer families
21698222 The viral protein ICP0 targets RNF8 and RNF168 for degradation, thereby preventing the deposition of repressive ubiquitin marks and counteracting this repair protein recruitment.
21664912 Studies indicate that Non-proteolytic ubiquitylation of chromatin surrounding DSBs, mediated by the RNF8/RNF168 ubiquitin ligase cascade, has emerged as a key mechanism for restoration of genome integrity.
21635870 These results suggest that RNF8 is downregulated in many cancer cells and inversely correlated with Plk1.
21558560 the differential requirement for the ubiquitin ligase RNF8 in facilitating repair of replication stress-associated DNA damage
21412056 The E3 Ubiquitin ligases, RNF8 and RNF168, are recruited to DNA damage foci in late mitosis, presumably to prime sites for the DNA damage response, 53BP1, recruitment in early G1.
20713529 Phosphorylated NPM1 may interact with RNF8-dependent ubiquitin conjugates at sites of DNA damage.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20081839 Data show that the ATM signalling mediator proteins MDC1, RNF8, RNF168 and 53BP1 are also required for heterochromatic DSB repair.
20080757 Ubiquitin ligase does not protect cells from Nutlin-3-mediated apoptosis, indicating that RNF8 does not regulate 53BP1 protein.
20075863 Data identify RNF8 and RNF168, cellular histone ubiquitin ligases responsible for anchoring repair factors at sites of damage, as new targets for ICP0-mediated degradation.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19797077 Nucleotide excision repair-induced H2A ubiquitination is dependent on MDC1 and RNF8 and reveals a universal DNA damage response.
19124460 subset of PTIP.PA1 complex is recruited to DNA damage sites via the RNF8-dependent pathway and is required for cell survival in response to DNA damage.
18948756 RNF8 readily mono-ubiquitinates PCNA in the presence of UbcH5c, and polyubiquitinates PCNA in the added presence of Ubc13/Uev1a.
18550271 Depletion of RAP80 or RNF8 impairs the translocation of BRCA1 to DNA damage sites and results in defective cell cycle checkpoint control and DSB repair
18337245 RNF8 ubiquitylation pathways are essential for 53BP1 regulation in response to ionizing radiation, whereas RNF8-independent pathways contribute to 53BP1 targeting and phosphorylation in response to UV light and other forms of DNA replication stress
18171988 RNF8 is the human orthologue of the yeast protein Dma1p
18077395 the human Ubc13/Rnf8 ubiquitin ligases control foci formation of the Rap80/Abraxas/Brca1/Brcc36 complex in response to DNA damage
18006705 results demonstrate how the DNA-damage response is orchestrated by ATM-dependent phosphorylation of MDC1 and RNF8-mediated ubiquitination
18001825 RNF8 is a novel DNA-damage-responsive protein that integrates protein phosphorylation and ubiquitylation signaling and plays a critical role in the cellular response to genotoxic stress.
18001824 RNF8 ubiquitylates histones at DNA double-strand breaks and promotes assembly of repair proteins.
17724460 Regulates the rate of exit from mitosis and cytokinesis.
14981089 results suggest a novel function of RNF8 as a regulator of RXR alpha-mediated transcriptional activity through interaction between their respective N-terminal regions

AA Sequence

MGEPGFFVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNP      1 - 70
EGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKN     71 - 140
DQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVSCESGQPVKSQGKGEVASTPSDNLDPKLTAL    141 - 210
EPSKTTGAPIYPGFPKVTEVHHEQKASNSSASQRSLQMFKVTMSRILRLKIQMQEKHEAVMNVKKQTQKG    211 - 280
NSKKVVQMEQELQDLQSQLCAEQAQQQARVEQLEKTFQEEEQHLQGLEIAQGEKDLKQQLAQALQEHWAL    281 - 350
MEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAH    351 - 420
SFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERKAKRLF         421 - 485
//

Text Mined References (79)

PMID Year Title
26869104 2016 VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage.
26734725 2015 The proximity ligation assay reveals that at DNA double-strand breaks WRAP53? associates with ?H2AX and controls interactions between RNF8 and MDC1.
26507658 2016 USP11 Is a Negative Regulator to ?H2AX Ubiquitylation by RNF8/RNF168.
26381412 2015 ATDC (Ataxia Telangiectasia Group D Complementing) Promotes Radioresistance through an Interaction with the RNF8 Ubiquitin Ligase.
25955491 2015 RNF8 plays an important role in the radioresistance of human nasopharyngeal cancer cells in vitro.
25483088 2014 miR-214-mediated downregulation of RNF8 induces chromosomal instability in ovarian cancer cells.
25417706 2015 Rad18 and Rnf8 facilitate homologous recombination by two distinct mechanisms, promoting Rad51 focus formation and suppressing the toxic effect of nonhomologous end joining.
25416956 2014 A proteome-scale map of the human interactome network.
25374327 2015 Genetic association study of RNF8 and BRDT variants with non-obstructive azoospermia in the Chinese Han population.
25337968 2014 Regulation of 53BP1 protein stability by RNF8 and RNF168 is important for efficient DNA double-strand break repair.
25304081 2014 The ubiquitin ligases RNF8 and RNF168 display rapid but distinct dynamics at DNA repair foci in living cells.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23615962 2013 The deubiquitylating enzyme USP44 counteracts the DNA double-strand break response mediated by the RNF8 and RNF168 ubiquitin ligases.
23442799 2013 Dma/RNF8 proteins are evolutionarily conserved E3 ubiquitin ligases that target septins.
23233665 2013 Identification of RNF8 as a ubiquitin ligase involved in targeting the p12 subunit of DNA polymerase ? for degradation in response to DNA damage.
23230272 2013 BAL1 and its partner E3 ligase, BBAP, link Poly(ADP-ribose) activation, ubiquitylation, and double-strand DNA repair independent of ATM, MDC1, and RNF8.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23115235 2012 The RING finger protein RNF8 ubiquitinates Nbs1 to promote DNA double-strand break repair by homologous recombination.
23038782 2012 MDC1 and RNF8 function in a pathway that directs BRCA1-dependent localization of PALB2 required for homologous recombination.
22980979 2012 RNF168 ubiquitinates K13-15 on H2A/H2AX to drive DNA damage signaling.
22865450 2012 RNF8 regulates assembly of RAD51 at DNA double-strand breaks in the absence of BRCA1 and 53BP1.
22814251 2012 Nucleolar exit of RNF8 and BRCA1 in response to DNA damage.
22705371 2012 A ubiquitin-binding protein, FAAP20, links RNF8-mediated ubiquitination to the Fanconi anemia DNA repair network.
22589545 2012 Molecular insights into the function of RING finger (RNF)-containing proteins hRNF8 and hRNF168 in Ubc13/Mms2-dependent ubiquitylation.
22531782 2012 A new non-catalytic role for ubiquitin ligase RNF8 in unfolding higher-order chromatin structure.
22508508 2012 DNA damage-inducible SUMOylation of HERC2 promotes RNF8 binding via a novel SUMO-binding Zinc finger.
22405594 2012 Viral E3 ubiquitin ligase-mediated degradation of a cellular E3: viral mimicry of a cellular phosphorylation mark targets the RNF8 FHA domain.
22373579 2012 RNF8- and RNF168-dependent degradation of KDM4A/JMJD2A triggers 53BP1 recruitment to DNA damage sites.
22266820 2012 The E3 ligase RNF8 regulates KU80 removal and NHEJ repair.
21911360 2012 Differential regulation of RNF8-mediated Lys48- and Lys63-based poly-ubiquitylation.
21857671 2011 DNA-damage response and repair activities at uncapped telomeres depend on RNF8.
21774837 2011 Mutation screening of the RNF8, UBC13 and MMS2 genes in Northern Finnish breast cancer families.
21698222 2011 The intrinsic antiviral defense to incoming HSV-1 genomes includes specific DNA repair proteins and is counteracted by the viral protein ICP0.
21664912 2011 The ubiquitin- and SUMO-dependent signaling response to DNA double-strand breaks.
21635870 2011 Plk1 is negatively regulated by RNF8.
21558560 2011 Critical roles of ring finger protein RNF8 in replication stress responses.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21412056 2011 Give me a break, but not in mitosis: the mitotic DNA damage response marks DNA double-strand breaks with early signaling events.
20713529 2010 Recruitment of phosphorylated NPM1 to sites of DNA damage through RNF8-dependent ubiquitin conjugates.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20550933 2010 ATM-dependent chromatin changes silence transcription in cis to DNA double-strand breaks.
20081839 2010 53BP1-dependent robust localized KAP-1 phosphorylation is essential for heterochromatic DNA double-strand break repair.
20080757 2010 The RNF8/RNF168 ubiquitin ligase cascade facilitates class switch recombination.
20075863 2010 A viral E3 ligase targets RNF8 and RNF168 to control histone ubiquitination and DNA damage responses.
20023648 2010 HERC2 coordinates ubiquitin-dependent assembly of DNA repair factors on damaged chromosomes.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19797077 2009 Nucleotide excision repair-induced H2A ubiquitination is dependent on MDC1 and RNF8 and reveals a universal DNA damage response.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19203579 2009 RNF168 binds and amplifies ubiquitin conjugates on damaged chromosomes to allow accumulation of repair proteins.
19203578 2009 The RIDDLE syndrome protein mediates a ubiquitin-dependent signaling cascade at sites of DNA damage.
19202061 2009 The Rap80-BRCC36 de-ubiquitinating enzyme complex antagonizes RNF8-Ubc13-dependent ubiquitination events at DNA double strand breaks.
19124460 2009 Accumulation of Pax2 transactivation domain interaction protein (PTIP) at sites of DNA breaks via RNF8-dependent pathway is required for cell survival after DNA damage.
19015238 2009 Histone ubiquitination associates with BRCA1-dependent DNA damage response.
18948756 2008 PCNA is ubiquitinated by RNF8.
18678647 2008 Noncanonical E2 variant-independent function of UBC13 in promoting checkpoint protein assembly.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18550271 2008 RAP80 and RNF8, key players in the recruitment of repair proteins to DNA damage sites.
18337245 2008 RNF8-dependent and RNF8-independent regulation of 53BP1 in response to DNA damage.
18171988 2007 Defective in mitotic arrest 1/ring finger 8 is a checkpoint protein that antagonizes the human mitotic exit network.
18077395 2007 Ubc13/Rnf8 ubiquitin ligases control foci formation of the Rap80/Abraxas/Brca1/Brcc36 complex in response to DNA damage.
18006705 2007 Orchestration of the DNA-damage response by the RNF8 ubiquitin ligase.
18001825 2007 RNF8 transduces the DNA-damage signal via histone ubiquitylation and checkpoint protein assembly.
18001824 2007 RNF8 ubiquitylates histones at DNA double-strand breaks and promotes assembly of repair proteins.
17724460 2008 Regulation of mitotic exit by the RNF8 ubiquitin ligase.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16215985 2006 The RING finger protein RNF8 recruits UBC13 for lysine 63-based self polyubiquitylation.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
14981089 2004 The RING finger protein, RNF8, interacts with retinoid X receptor alpha and enhances its transcription-stimulating activity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11322894 2001 N-Terminally extended human ubiquitin-conjugating enzymes (E2s) mediate the ubiquitination of RING-finger proteins, ARA54 and RNF8.
9852682 1998 Isolation, tissue expression, and chromosomal assignment of a novel human gene which encodes a protein with RING finger motif.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.