Property Summary

NCBI Gene PubMed Count 31
PubMed Score 14.85
PubTator Score 23.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

 MGI Phenotype (1)

Protein-protein Interaction (11)

Gene RIF (17)

PMID Text
26183966 we found that RNF5 is differentially expressed in human bronchial epithelia from CF vs. control patients. Our results identify RNF5 as a target for therapeutic modalities to antagonize mutant CFTR proteins.
25759021 RNF5 is involved in the regulation of the L-glutamine carrier proteins SLC1A5 and SLC38A2.
23798571 Our data suggest that RNF5 regulates the turnover of specific G protein-coupled receptors by ubiquitinating JAMP and preventing proteasome recruitment.
22750442 Rma1, an E3 ubiquitin ligase localized in the ER membrane, is involved in Pendrin degradation
22433715 In addition to confirming one of the top findings in the meta-analysis, TRIM26, RNF5 and HLA-DRB3 have been identified as potential candidate genes for schizophrenia.
22190034 HIV-1 gp160 is identified to have a physical interaction with ring finger protein 5, E3 ubiquitin protein ligase (RNF5) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21148293 JB12 cooperates with cytosolic Hsc70 and the ubiquitin ligase RMA1 to target CFTR and CFTRDeltaF508 for degradation.
19851445 Observational study of gene-disease association. (HuGE Navigator)
19285439 E3 ubiquitin ligase RNF5 interacted with MITA in a viral-infection-dependent manner
19269966 RNF5 associates with JAMP in the ER membrane. This association results in Ubc13-dependent RNF5-mediated noncanonical ubiquitination of JAMP.
19143821 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18976975 Knockdown of ring finger protein 5, E3 ubiquitin protein ligase (RNF5) by siRNA has both activating and inhibiting activities on HIV-1 replication in HeLa P4/R5 cells, suggesting a regulatory role in HIV replication
17804730 RNF5 is a novel regulator of breast cancer progression through its effect on actin cytoskeletal alterations.
16176924 efficient bacterial escape into the cytosol of epithelial cells requires HsRMA1-mediated SopA ubiquitination and contributes to Salmonella-induced enteropathogenicity
15485865 the G(16)-mediated activation of IKK/NFkappaB by N(6)-cyclohexyladenosine requires a complex signaling network composed of multiple intermediates
12861019 RNF5 regulates cell motility by targeting paxillin ubiquitination and altered localization
11603805 found in cerebral microvessels endothelium

AA Sequence

MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAG      1 - 70
ISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNA     71 - 140
HEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI                                  141 - 180
//

Text Mined References (37)

PMID Year Title
26183966 2015 Genetic Inhibition Of The Ubiquitin Ligase Rnf5 Attenuates Phenotypes Associated To F508del Cystic Fibrosis Mutation.
25759021 2015 Regulation of glutamine carrier proteins by RNF5 determines breast cancer response to ER stress-inducing chemotherapies.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24019521 2013 RNF185 is a novel E3 ligase of endoplasmic reticulum-associated degradation (ERAD) that targets cystic fibrosis transmembrane conductance regulator (CFTR).
23798571 2013 Novel, gel-free proteomics approach identifies RNF5 and JAMP as modulators of GPCR stability.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22750442 2012 Roles of 17-AAG-induced molecular chaperones and Rma1 E3 ubiquitin ligase in folding and degradation of Pendrin.
22433715 2012 Expression QTL analysis of top loci from GWAS meta-analysis highlights additional schizophrenia candidate genes.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21323541 2011 Risk HLA-DQA1 and PLA(2)R1 alleles in idiopathic membranous nephropathy.
21148293 2011 The endoplasmic reticulum-associated Hsp40 DNAJB12 and Hsc70 cooperate to facilitate RMA1 E3-dependent degradation of nascent CFTRDeltaF508.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19285439 2009 The ubiquitin ligase RNF5 regulates antiviral responses by mediating degradation of the adaptor protein MITA.
19269966 2009 Regulation of endoplasmic reticulum-associated degradation by RNF5-dependent ubiquitination of JNK-associated membrane protein (JAMP).
19143821 2009 Association of MHC SNP genotype with susceptibility to type 1 diabetes: a modified survival approach.
17804730 2007 Increased expression of the E3 ubiquitin ligase RNF5 is associated with decreased survival in breast cancer.
16901789 2006 Sequential quality-control checkpoints triage misfolded cystic fibrosis transmembrane conductance regulator.
16176924 2005 Recognition and ubiquitination of Salmonella type III effector SopA by a ubiquitin E3 ligase, HsRMA1.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485865 2004 G16-mediated activation of nuclear factor kappaB by the adenosine A1 receptor involves c-Src, protein kinase C, and ERK signaling.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
14656967 2003 Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12861019 2003 RNF5, a RING finger protein that regulates cell motility by targeting paxillin ubiquitination and altered localization.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329381 2001 Rma1, a novel type of RING finger protein conserved from Arabidopsis to human, is a membrane-bound ubiquitin ligase.
10967549 2000 The multi-PDZ domain protein MUPP1 is a cytoplasmic ligand for the membrane-spanning proteoglycan NG2.
9533025 1997 Cloning, expression and mapping of a novel RING-finger gene (RNF5), a human homologue of a putative zinc-finger gene from Caenorhabditis elegans.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
2259622 1990 Human major histocompatibility complex contains a new cluster of genes between the HLA-D and complement C4 loci.