Property Summary

NCBI Gene PubMed Count 38
PubMed Score 42.24
PubTator Score 35.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma -2.000 2.5e-03
posterior fossa group A ependymoma -2.000 2.6e-16
glioblastoma -1.800 1.4e-03
osteosarcoma -2.395 2.2e-06
atypical teratoid / rhabdoid tumor -2.000 3.8e-09
primitive neuroectodermal tumor -1.200 1.0e-03
adult high grade glioma -2.100 7.3e-07
pilocytic astrocytoma -1.700 3.4e-10
subependymal giant cell astrocytoma -2.732 3.4e-03

 GO Component (1)

Protein-protein Interaction (12)

Gene RIF (22)

PMID Text
26963794 HPV 16 E2 can modulate ErbB-3 by interacting with Nrdp-1, which is involved in the regulation of this receptor, via ubiquitination and degradation.
26464195 ABPN downregulates multiple components of the EGFR/ErbB3 signaling pathway through Nrdp1 activation.
26088461 The results of this study suggested that Nrdp1-mediated ErbB3 degradation suppresses glioma migration and invasion and that loss of Nrdp1 may amplify ErbB3 signaling to contribute to glioma migration and invasion.
25926384 The regulation of MMP7 by Nrdp1 in CRC cells could be inhibited by miR-497 through suppressing Nrdp1 translation.
25519010 Nrdp1 may serve as a useful biomarker for the clinical outcome and efficacy of adjuvant anthracyclines-based chemotherapy in breast cancer.
25355637 Lower expression of Nrdp1 in human glioma contributes tumor progression by reducing apoptosis.
25330950 Our findings thus reveal Nrdp1, EGFR signaling, and MMP7 as promising therapeutic targets for preventing the metastasis of colorectal cancer .
24867101 Data suggest that neuregulin receptor degradation protein-1 (Nrtp1) may induce cell-cycle inhibitor p27 nuclear retention to directly inhibit proliferation of colorectal cancer (CRC) cells.
24519943 Coiled-coil domain deletion abrogates Nrdp1 oligomerization and suppresses Nrdp1 but not ErbB3 ubiquitination and degradation.
24259665 Phosphorylation of RNF41 by Par-1b regulates basolateral membrane targeting of laminin-111 receptors.
23750007 Balanced reciprocal cross-regulation of RNF41 and USP8 determines whether receptors are sorted for lysosomal degradation or recycling, this way regulating basal cytokine receptor levels.
21693106 these data provide insights into understanding the potential role of Nrdp1 in cell growth, apoptosis and oxidative stress, and in the pathogenesis of Parkinson's disease.
21576364 Data demonstrate that Nrdp1 preferentially associates with the nascent form of ErbB3 to accelerate its degradation, and that the two proteins colocalize at the endoplasmic reticulum.
21378310 RNF41 interacts with JAK2-associated cytokine receptor complexes and modulates their cell surface exposure and signalling.
20628057 Post-transcriptional mechanisms contribute to the suppression of the ErbB3 negative regulator protein Nrdp1 in mammary tumors.
20587519 Observations point to a model of CRPC development in which progression of PCa to castration resistance is associated with the inability of AR to transcriptionally regulate Nrdp1, and predict that inhibition of ErbB3 during AW may impair CRPC development.
20098290 RNF41 mRNA measured by real time reverse-transcriptase polymerase chain reaction reaction quantifies heart allograft apoptosis in graft rejection.
19800834 This study do not support the hypothesis of a major role for the Nrdp1 gene in PD development in the Chinese population.
17210635 Neuregulin 1-induced protein stability cascade involving USP8 and Nrdp1 mediates the down-regulation of ErbB3
17035239 The USP8 recognition domain of NRDP1 has a novel protein fold that interacts with a conserved peptide loop of the rhodanese domain.
15314180 Results indicate that Nrdp1 is a specific target for the USP8 deubiquitinating enzyme and are consistent with a model where USP8 augments Nrdp1 activity by mediating its stabilization
14765125 Nrdp1 can be important in the initiation of apoptosis by catalyzing ubiquitination and degradation of BRUCE.

AA Sequence

MGYDVTRFQGDVDEDLICPICSGVLEEPVQAPHCEHAFCNACITQWFSQQQTCPVDRSVVTVAHLRPVPR      1 - 70
IMRNMLSKLQIACDNAVFGCSAVVRLDNLMSHLSDCEHNPKRPVTCEQGCGLEMPKDELPNHNCIKHLRS     71 - 140
VVQQQQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAIRSVNPNLQNLEETIEYNEILEWVNSLQPAR    141 - 210
VTRWGGMISTPDAVLQAVIKRSLVESGCPASIVNELIENAHERSWPQGLATLETRQMNRRYYENYVAKRI    211 - 280
PGKQAVVVMACENQHMGDDMVQEPGLVMIFAHGVEEI                                     281 - 317
//

Text Mined References (43)

PMID Year Title
26963794 2016 Human papillomavirus 16 E2 interacts with neuregulin receptor degradation protein 1 affecting ErbB-3 expression in vitro and in clinical samples of cervical lesions.
26464195 2015 The retinoic acid derivative, ABPN, inhibits pancreatic cancer through induction of Nrdp1.
26088461 2015 Nrdp1-mediated ErbB3 degradation inhibits glioma cell migration and invasion by reducing cytoplasmic localization of p27(Kip1).
25926384 2015 MiR-497 promotes metastasis of colorectal cancer cells through Nrdp1 inhibition.
25519010 2015 Nrdp1 expression to predict clinical outcome and efficacy of adjuvant anthracyclines-based chemotherapy in breast cancer: A retrospective study.
25416956 2014 A proteome-scale map of the human interactome network.
25355637 2014 Lower expression of Nrdp1 in human glioma contributes tumor progression by reducing apoptosis.
25330950 2015 Nrdp1 inhibits metastasis of colorectal cancer cells by EGFR signaling-dependent MMP7 modulation.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24949970 2014 The diabetes susceptibility gene Clec16a regulates mitophagy.
24867101 2014 Nrdp1 inhibits growth of colorectal cancer cells by nuclear retention of p27.
24519943 2014 Oligomerization of the Nrdp1 E3 ubiquitin ligase is necessary for efficient autoubiquitination but not ErbB3 ubiquitination.
24259665 2014 Phosphorylation of the E3 ubiquitin ligase RNF41 by the kinase Par-1b is required for epithelial cell polarity.
24105792 2014 Protein microarray characterization of the S-nitrosoproteome.
24056301 2013 The deubiquitylase USP33 discriminates between RALB functions in autophagy and innate immune response.
23750007 2013 Reciprocal cross-regulation between RNF41 and USP8 controls cytokine receptor sorting and processing.
21693106 2011 Overexpression of Nrdp1/FLRF sensitizes cells to oxidative stress.
21576364 2011 Quantity control of the ErbB3 receptor tyrosine kinase at the endoplasmic reticulum.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21378310 2011 RNF41 (Nrdp1) controls type 1 cytokine receptor degradation and ectodomain shedding.
20628057 2010 Post-transcriptional mechanisms contribute to the suppression of the ErbB3 negative regulator protein Nrdp1 in mammary tumors.
20587519 2010 Nrdp1-mediated regulation of ErbB3 expression by the androgen receptor in androgen-dependent but not castrate-resistant prostate cancer cells.
20098290 2010 Apollon/RNF41 myocardial messenger RNA diagnoses cardiac allograft apoptosis in rejection.
19800834 2010 Genetic screening for mutations in the Nrdp1 gene in Parkinson disease patients in a Chinese population.
19483718 2009 The E3 ubiquitin ligase Nrdp1 'preferentially' promotes TLR-mediated production of type I interferon.
18541373 2008 Parkin is ubiquitinated by Nrdp1 and abrogates Nrdp1-induced oxidative stress.
17210635 2007 Neuregulin-induced ErbB3 downregulation is mediated by a protein stability cascade involving the E3 ubiquitin ligase Nrdp1.
17145873 2006 Loss of Nrdp1 enhances ErbB2/ErbB3-dependent breast tumor cell growth.
17035239 2006 Amino-terminal dimerization, NRDP1-rhodanese interaction, and inhibited catalytic domain conformation of the ubiquitin-specific protease 8 (USP8).
16541075 2006 The finished DNA sequence of human chromosome 12.
15632191 2005 RING finger ubiquitin-protein isopeptide ligase Nrdp1/FLRF regulates parkin stability and activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15314180 2004 Stabilization of the E3 ubiquitin ligase Nrdp1 by the deubiquitinating enzyme USP8.
14765125 2004 Nrdp1-mediated degradation of the gigantic IAP, BRUCE, is a novel pathway for triggering apoptosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676191 2004 Comprehensive proteomic analysis of human Par protein complexes reveals an interconnected protein network.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12411582 2002 Nrdp1/FLRF is a ubiquitin ligase promoting ubiquitination and degradation of the epidermal growth factor receptor family member, ErbB3.
11867753 2002 An RBCC protein implicated in maintenance of steady-state neuregulin receptor levels.
11358394 FLRF, a novel evolutionarily conserved RING finger gene, is differentially expressed in mouse fetal and adult hematopoietic stem cells and progenitors.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.