Property Summary

NCBI Gene PubMed Count 45
PubMed Score 74.69
PubTator Score 52.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 1.4e-04
ovarian cancer 8491 1.6e-04
breast carcinoma 1614 2.8e-03
Disease Target Count Z-score Confidence
Cancer 2346 3.003 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.200 1.4e-04
breast carcinoma 1.300 2.8e-03
ovarian cancer -1.300 1.6e-04

Gene RIF (26)

PMID Text
26450775 Data show that RNF4 is a SUMO-targeted ubiquitin ligase that targets TRF2 for ubiquitination.
26299341 RNF4 negatively regulates NF-kappaB signaling by down-regulating TAB2
25969536 novel insight into cross-talk between ubiquitin and SUMO and uncover USP11 and RNF4 as a balanced SUMO-targeted ubiquitin ligase/protease pair with a role in the DDR.
25960396 RNF4 enhances Ube2E1 self-ubiquitination.
25895136 c-Myc is targeted to the proteasome for degradation in a SUMOylation-dependent manner, regulated by PIAS1, SENP7 and RNF4
25751062 Cells lacking RNF4 exhibited interstrand cross-linker hypersensitivity. The gene encoding RNF4 was epistatic with the other genes encoding members of the FA/BRCA pathway.
25588990 RecQ-like helicase BLM subcellular localization is regulated by SUMO-targeted ubiquitin ligase RNF4 in response to DNA damage, presumably to prevent illegitimate recombination events.
25355316 RNF4 mediates ubiquitination and turnover of MeCP2 and thus derepresses transcription from DNA methylation.
24969970 NMR spectroscopy and biochemical characterization reveal how RNF4 manipulates the conformation of the SUMO chain, thereby facilitating optimal delivery of the distal SUMO domain for ubiquitin transfer.
24907272 the ARM dynamically regulates the SIM-dependent recruitment of targets to RNF4, which could be critical to dynamically fine-tune the abundance of Ser(P)-824-SUMO-KAP1 and, potentially, other SUMOylated proteins during DNA damage response.
24656128 SUMO chain-induced dimerization activates RNF4.
24151981 The sequence and spacing of the SIMs (SUMO-interaction motifs) in RNF4 regulate the avidity-driven recognition of substrate proteins carrying SUMO chains of variable length.
23504328 RNF4 is a SUMO-targeted ubiquitin E3 ligase of Rta.
23211528 connect ubiquitin- and SUMO-dependent DSB recognition, revealing that RNF4-synthesized hybrid SUMO-ubiquitin chains are recognized by RAP80 to promote BRCA1 recruitment and DNA repair.
23028697 SUMO interacting motif is dispensable for PML SUMOylation and interaction with RNF4 but is required for efficient PML ubiquitination, recruitment of proteasome components within NBs and proteasome-dependent degradation of PML in response to AsO
22661230 RNF4 is a novel DNA damage-responsive protein that plays a role in homologous recombination and integrates SUMO modification and ubiquitin signaling in the cellular response to genotoxic stress.
22661229 RNF4 operates as a DSB response factor at the crossroads between the SUMO and ubiquitin systems.
22106342 RNF4 regulates the localization and function of the HTLV-1 oncoprotein Tax.
20696907 Mechanistic studies show that RNF4 interacts with and requires the base excision repair enzymes TDG and APE1 for active demethylation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19524139 The different subtypes of malignant ovarian germ cell tumours all express ERalpha, ERbeta, and SNURF.
19380586 sumoylation- and Sumo binding domain-dependent PML oligomerization within nuclear bodies is sufficient for RNF4-mediated PML degradation
18408734 Data show that the RING-domain-containing ubiquitin E3 ligase, RNF4 (also known as SNURF), targets poly-SUMO-modified proteins for degradation mediated by ubiquitin.
12885770 RNF4 is a negative regulator of TRPS1 activity
12874792 Functional analysis of the mouse homolog
12351196 Functional analysis of the rat homolog

AA Sequence

MSTRKRRGGAINSRQAQKRTREATSTPEISLEAEPIELVETAGDEIVDLTCESLEPVVVDLTHNDSVVIV      1 - 70
DERRRPRRNARRLPQDHADSCVVSSDDEELSRDRDVYVTTHTPRNARDEGATGLRPSGTVSCPICMDGYS     71 - 140
EIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI                        141 - 190
//

Text Mined References (53)

PMID Year Title
26450775 2015 PIAS1-mediated sumoylation promotes STUbL-dependent proteasomal degradation of the human telomeric protein TRF2.
26299341 2015 RNF4 negatively regulates NF-?B signaling by down-regulating TAB2.
25969536 2015 Ubiquitin-specific Protease 11 (USP11) Deubiquitinates Hybrid Small Ubiquitin-like Modifier (SUMO)-Ubiquitin Chains to Counteract RING Finger Protein 4 (RNF4).
25960396 2015 RING E3-Catalyzed E2 Self-Ubiquitination Attenuates the Activity of Ube2E Ubiquitin-Conjugating Enzymes.
25895136 2015 c-Myc is targeted to the proteasome for degradation in a SUMOylation-dependent manner, regulated by PIAS1, SENP7 and RNF4.
25751062 2015 RNF4-mediated polyubiquitination regulates the Fanconi anemia/BRCA pathway.
25588990 2015 Disruption of SUMO-targeted ubiquitin ligases Slx5-Slx8/RNF4 alters RecQ-like helicase Sgs1/BLM localization in yeast and human cells.
25355316 2014 RING finger protein 4 (RNF4) derepresses gene expression from DNA methylation.
24969970 2014 Structural insight into SUMO chain recognition and manipulation by the ubiquitin ligase RNF4.
24907272 2014 An arginine-rich motif of ring finger protein 4 (RNF4) oversees the recruitment and degradation of the phosphorylated and SUMOylated Krüppel-associated box domain-associated protein 1 (KAP1)/TRIM28 protein during genotoxic stress.
24714598 2014 RNF4 interacts with both SUMO and nucleosomes to promote the DNA damage response.
24656128 2014 SUMO chain-induced dimerization activates RNF4.
24151981 2014 Multivalent interactions of the SUMO-interaction motifs in RING finger protein 4 determine the specificity for chains of the SUMO.
23504328 2013 Role of RNF4 in the ubiquitination of Rta of Epstein-Barr virus.
23211528 2012 RNF4-dependent hybrid SUMO-ubiquitin chains are signals for RAP80 and thereby mediate the recruitment of BRCA1 to sites of DNA damage.
23028697 2012 Requirement of PML SUMO interacting motif for RNF4- or arsenic trioxide-induced degradation of nuclear PML isoforms.
22661230 2012 SUMO-targeted ubiquitin E3 ligase RNF4 is required for the response of human cells to DNA damage.
22661229 2012 RNF4, a SUMO-targeted ubiquitin E3 ligase, promotes DNA double-strand break repair.
22106342 2012 The Sumo-targeted ubiquitin ligase RNF4 regulates the localization and function of the HTLV-1 oncoprotein Tax.
20943951 2010 Arsenic-induced SUMO-dependent recruitment of RNF4 into PML nuclear bodies.
20696907 2010 Identification of RING finger protein 4 (RNF4) as a modulator of DNA demethylation through a functional genomics screen.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20212317 2010 The SUMO protease SENP6 is essential for inner kinetochore assembly.
20026589 2010 RNF4 and VHL regulate the proteasomal degradation of SUMO-conjugated Hypoxia-Inducible Factor-2alpha.
19779455 2009 PARP-1 transcriptional activity is regulated by sumoylation upon heat shock.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19524139 2009 Oestrogen receptors and small nuclear ring finger protein 4 (RNF4) in malignant ovarian germ cell tumours.
19380586 2009 Role of SUMO in RNF4-mediated promyelocytic leukemia protein (PML) degradation: sumoylation of PML and phospho-switch control of its SUMO binding domain dissected in living cells.
19307308 2009 Extracellular signal-regulated kinase mitogen-activated protein kinase signaling initiates a dynamic interplay between sumoylation and ubiquitination to regulate the activity of the transcriptional activator PEA3.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18408734 2008 RNF4 is a poly-SUMO-specific E3 ubiquitin ligase required for arsenic-induced PML degradation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15707587 2005 SUMO-1 promotes association of SNURF (RNF4) with PML nuclear bodies.
15572661 2004 Negative modulation of androgen receptor transcriptional activity by Daxx.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12885770 2003 The RING finger protein RNF4, a co-regulator of transcription, interacts with the TRPS1 transcription factor.
12874792 2003 Translational regulation of a novel testis-specific RNF4 transcript.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12351196 2002 Expression of the nuclear RING finger protein SNURF/RNF4 during rat testis development suggests a role in spermatid maturation.
11719514 2002 PATZ attenuates the RNF4-mediated enhancement of androgen receptor-dependent transcription.
11696545 2002 Cooperative coactivation of estrogen receptor alpha in ZR-75 human breast cancer cells by SNURF and TATA-binding protein.
11319220 2001 The RING finger protein SNURF is a bifunctional protein possessing DNA binding activity.
10849425 2000 Interaction between the transcription factor SPBP and the positive cofactor RNF4. An interplay between protein binding zinc fingers.
10822263 2000 Rnf4, a RING protein expressed in the developing nervous and reproductive systems, interacts with Gscl, a gene within the DiGeorge critical region.
10713105 2000 A novel member of the BTB/POZ family, PATZ, associates with the RNF4 RING finger protein and acts as a transcriptional repressor.
10617653 2000 Coregulator small nuclear RING finger protein (SNURF) enhances Sp1- and steroid receptor-mediated transcription by different mechanisms.
9734812 1998 The primary structure and genomic organization of five novel transcripts located close to the Huntington's disease gene on human chromosome 4p16.3.
9710597 1998 Identification of a novel RING finger protein as a coregulator in steroid receptor-mediated gene transcription.
9479498 1998 Identification and characterization of a novel RING-finger gene (RNF4) mapping at 4p16.3.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.