Property Summary

NCBI Gene PubMed Count 6
PubMed Score 7.05
PubTator Score 7.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -1.900 6.1e-08
astrocytic glioma 1.200 1.6e-02
oligodendroglioma 1.200 8.0e-04
psoriasis -1.400 1.7e-09
osteosarcoma -1.281 3.2e-02
atypical teratoid / rhabdoid tumor -1.200 3.6e-04
glioblastoma 1.100 4.9e-04
medulloblastoma -1.300 2.8e-03
medulloblastoma, large-cell -1.200 1.8e-02
primitive neuroectodermal tumor 1.100 1.3e-03
non-small cell lung cancer 1.046 2.4e-15
intraductal papillary-mucinous neoplasm ... 1.700 4.3e-04
lung cancer 1.100 3.2e-03
active ulcerative colitis 1.327 3.0e-03
Breast cancer 1.300 8.7e-08
gastric carcinoma 1.400 7.0e-03
invasive ductal carcinoma 1.200 1.1e-02
pituitary cancer -1.300 2.5e-04

Gene RIF (1)

PMID Text
17850865 Results indicate that RNF24 interacts with TRPC cation channels in the Golgi apparatus and affects TRPC intracellular trafficking without affecting their activity.

AA Sequence

MSSDFPHYNFRMPNIGFQNLPLNIYIVVFGTAIFVFILSLLFCCYLIRLRHQAHKEFYAYKQVILKEKVK      1 - 70
ELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQLHSKQDRGPPQGP     71 - 140
LPGAENIV                                                                  141 - 148
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
17850865 2008 RNF24, a new TRPC interacting protein, causes the intracellular retention of TRPC.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.