Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.62
PubTator Score 0.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.016 9.2e-03
atypical teratoid / rhabdoid tumor 1.300 1.1e-03
medulloblastoma, large-cell -1.400 2.4e-02
adrenocortical carcinoma -1.126 4.0e-02
pancreatic ductal adenocarcinoma liver m... -1.246 2.1e-02
tuberculosis 2.000 3.0e-07
non-small cell lung cancer 1.049 7.6e-06
intraductal papillary-mucinous carcinoma... -1.900 9.2e-03
Breast cancer -1.800 4.3e-06
ovarian cancer -1.600 2.7e-04

Gene RIF (3)

PMID Text
25298122 The high expression of RNF217 in certain human leukemias suggests that the deregulation of this gene could be a more common mechanism in leukemogenesis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18978678 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGEEQSTVSGGGGPQESQTLASGTAGHPEPPRPQGDSARAPPLRAASAEPSGGGCGSDWGCADTSAPEPA      1 - 70
RSLGPPGWSKSRAPAQPAGLALTGPLNPQTLPLQLELEEEEEEAGDRKEGGDEQQEAPPGEELEPRTRVG     71 - 140
AADGLVLDVLGQRRPSLAKRQVFCSVYCVESDLPEAPASEQLSPPASPPGAPPVLNPPSTRSSFPSPRLS    141 - 210
LPTDSLSPDGGSIELEFYLAPEPFSMPSLLGAPPYSGLGGVGDPYVPLMVLMCRVCLEDKPIKPLPCCKK    211 - 280
AVCEECLKVYLSAQVQLGQVEIKCPITECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDSSTKPCPQCK    281 - 350
HFTTFKKKGHIPTPSRSESKYKIQCPTCQFVWCFKCHSPWHEGVNCKEYKKGDKLLRHWASEIEHGQRNA    351 - 420
QKCPKCKIHIQRTEGCDHMTCSQCNTNFCYRCGERYRQLRFFGDHTSNLSIFGCKYRYLPERPHLRRLVR    421 - 490
GSVCAGKLFIAPLIMVLGLALGAIAVVIGLFVFPIYCLCKKQRKRSRTGMHW                      491 - 542
//

Text Mined References (11)

PMID Year Title
26216882 2015 Regulation of RNF144A E3 Ubiquitin Ligase Activity by Self-association through Its Transmembrane Domain.
25298122 2014 Identification and characterization of OSTL (RNF217) encoding a RING-IBR-RING protein adjacent to a translocation breakpoint involving ETV6 in childhood ALL.
24957874 2011 The Role of the Transmembrane RING Finger Proteins in Cellular and Organelle Function.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.