Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q6NUR6 B7Z8S6
Symbols RNF216L
hCG2040556

Gene

 Compartment GO Term (0)

AA Sequence

MEEGNNNEEVIHLNNFHCHRGQDFVIFFWKTQIIQREKTESL                                  1 - 42
//

Text Mined References (6)

PMID Year Title