Property Summary

NCBI Gene PubMed Count 29
PubMed Score 17.14
PubTator Score 15.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.100 2.2e-05

Gene RIF (15)

PMID Text
25841028 Novel RNF216 mutations causing an Huntington-like phenotype with pure monogenic recessive inheritance. .
24945773 Loss of Triad3A mimics and occludes Arc-dependent forms of synaptic plasticity.
23656588 The syndrome of hypogonadotropic hypogonadism, ataxia, and dementia can be caused by inactivating mutations in RNF216 or by the combination of mutations in RNF216 and OTUD4.
21270397 By promoting polyubiquitylation and degradation, E3 ubiquitin ligase Triad3A is identified as an interaction partner for the killer cell Ig-like receptor KIR2DL4 cytoplasmic domain.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19893624 Triad3A represents a versatile E3 ubiquitin ligase that negatively regulates RIG-like receptor signaling by targeting TRAF3 for degradation following RNA virus infection.
19690434 Gene expression of RIPK3 and RNF216 in PBMC could identify those obese subjects, who will regain more weight after a successful initial weight loss. The mRNA levels of these genes could be nutrigenomic biomarkers for predicting obesity treatment outcome.
19149577 Triad 3/ZIN binds to purified HIV-1 Vif in vitro, interacts with HIV-1 Vif in transfected human 293T cells, and can impair viral DNA synthesis by two-fold when overexpressed in cells69
18854154 Knockdown of ring finger protein 216 (RNF216; TRIAD3) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
16968706 Triad3A regulates ubiquitination and proteasomal degradation of RIP1 following disruption of Hsp90 binding and play a crucial role in innate immunity
15367624 ZIN binds to purified Vif in vitro and Triad 3/ZIN interacts with HIV-1 Vif in transfected human 293T cells, as demonstrated by coimmunoprecipitation
15367624 Triad 3/ZIN binds to purified HIV-1 Vif in vitro, interacts with HIV-1 Vif in transfected human 293T cells, and can impair viral DNA synthesis by two-fold when overexpressed in cells69
12600646 Triad 3/ZIN binds to purified HIV-1 Vif in vitro, interacts with HIV-1 Vif in transfected human 293T cells, and can impair viral DNA synthesis by two-fold when overexpressed in cells69
11854271 interacts with RIP and inhibits tnf and il1-induced NFKB activation

AA Sequence

MEEGNNNEEVIHLNNFHCHRGQEWINLRDGPITISDSSDEERIPMLVTPAPQQHEEEDLDDDVILTEDDS      1 - 70
EDDYGEFLDLGPPGISEFTKPSGQTEREPKPGPSHNQAANDIVNPRSEQKVIILEEGSLLYTESDPLETQ     71 - 140
NQSSEDSETELLSNLGESAALADDQAIEEDCWLDHPYFQSLNQQPREITNQVVPQERQPEAELGRLLFQH    141 - 210
EFPGPAFPRPEPQQGGISGPSSPQPAHPLGEFEDQQLASDDEEPGPAFPMQESQEPNLENIWGQEAAEVD    211 - 280
QELVELLVKETEARFPDVANGFIEEIIHFKNYYDLNVLCNFLLENPDYPKREDRIIINPSSSLLASQDET    281 - 350
KLPKIDFFDYSKLTPLDQRCFIQAADLLMADFKVLSSQDIKWALHELKGHYAITRKALSDAIKKWQELSP    351 - 420
ETSGKRKKRKQMNQYSYIDFKFEQGDIKIEKRMFFLENKRRHCRSYDRRALLPAVQQEQEFYEQKIKEMA    421 - 490
EHEDFLLALQMNEEQYQKDGQLIECRCCYGEFPFEELTQCADAHLFCKECLIRYAQEAVFGSGKLELSCM    491 - 560
EGSCTCSFPTSELEKVLPQTILYKYYERKAEEEVAAAYADELVRCPSCSFPALLDSDVKRFSCPNPHCRK    561 - 630
ETCRKCQGLWKEHNGLTCEELAEKDDIKYRTSIEEKMTAARIRKCHKCGTGLIKSEGCNRMSCRCGAQMC    631 - 700
YLCRVSINGYDHFCQHPRSPGAPCQECSRCSLWTDPTEDDEKLIEEIQKEAEEEQKRKNGENTFKRIGPP    701 - 770
LEKPVEKVQRVEALPRPVPQNLPQPQMPPYAFAHPPFPLPPVRPVFNNFPLNMGPIPAPYVPPLPNVRVN    771 - 840
YDFGPIHMPLEHNLPMHFGPQPRHRF                                                841 - 866
//

Text Mined References (33)

PMID Year Title
25841028 2015 RNF216 mutations as a novel cause of autosomal recessive Huntington-like disorder.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24945773 2014 Triad3A regulates synaptic strength by ubiquitination of Arc.
23656588 2013 Ataxia, dementia, and hypogonadotropism caused by disordered ubiquitination.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21270397 2011 Ubiquitylation of an internalized killer cell Ig-like receptor by Triad3A disrupts sustained NF-?B signaling.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19893624 2009 The E3 ubiquitin ligase Triad3A negatively regulates the RIG-I/MAVS signaling pathway by targeting TRAF3 for degradation.
19690434 2009 Expression of two inflammation-related genes (RIPK3 and RNF216) in mononuclear cells is associated with weight-loss regain in obese subjects.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16968706 2006 Triad3A regulates ubiquitination and proteasomal degradation of RIP1 following disruption of Hsp90 binding.
16381901 2006 The LIFEdb database in 2006.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15367624 2004 Ring finger protein ZIN interacts with human immunodeficiency virus type 1 Vif.
15107846 2004 Triad3A, an E3 ubiquitin-protein ligase regulating Toll-like receptors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12600646 2003 The role of Vif during HIV-1 infection: interaction with novel host cellular factors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11854271 2002 A novel zinc finger protein interacts with receptor-interacting protein (RIP) and inhibits tumor necrosis factor (TNF)- and IL1-induced NF-kappa B activation.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10527689 1999 Immunoglobulin VH gene expression in human aging.
10422847 1999 TRIADs: a new class of proteins with a novel cysteine-rich signature.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8076819 1994 The addition of 5'-coding information to a 3'-directed cDNA library improves analysis of gene expression.