Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus -1.100 2.8e-03
intraductal papillary-mucinous carcinoma... -1.200 1.7e-03
intraductal papillary-mucinous neoplasm ... -1.100 1.7e-02
osteosarcoma -1.130 3.4e-04

 GO Function (1)

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

MAASEVAGVVANAPSPPESSSLCASKSDEGLPDGLSTKDSAQKQKNSPLLSVSSQTITKENNRNVHLEHS      1 - 70
EQNPGSSAGDTSAAHQVVLGENLIATALCLSGSGSQSDLKDVASTAGEEGDTSLRESLHPVTRSLKAGCH     71 - 140
TKQLASRNCSEEKSPQTSILKEGNRDTSLDFRPVVSPANGVEGVRVDQDDDQDSSSLKLSQNIAVQTDFK    141 - 210
TADSEVNTDQDIEKNLDKMMTERTLLKERYQEVLDKQRQVENQLQVQLKQLQQRREEEMKNHQEILKAIQ    211 - 280
DVTIKREETKKKIEKEKKEFLQKEQDLKAEIEKLCEKGRREVWEMELDRLKNQDGEINRNIMEETERAWK    281 - 350
AEILSLESRKELLVLKLEEAEKEAELHLTYLKSTPPTLETVRSKQEWETRLNGVRIMKKNVRDQFNSHIQ    351 - 420
LVRNGAKLSSLPQIPTPTLPPPPSETDFMLQVFQPSPSLAPRMPFSIGQVTMPMVMPSADPRSLSFPILN    421 - 490
PALSQPSQPSSPLPGSHGRNSPGLGSLVSPHGPHMPPAASIPPPPGLGGVKASAETPRPQPVDKLEKILE    491 - 560
KLLTRFPQCNKAQMTNILQQIKTARTTMAGLTMEELIQLVAARLAEHERVAASTQPLGRIRALFPAPLAQ    561 - 630
ISTPMFLPSAQVSYPGRSSHAPATCKLCLMCQKLVQPSELHPMACTHVLHKECIKFWAQTNTNDTCPFCP    631 - 700
TLK                                                                       701 - 703
//

Text Mined References (13)

PMID Year Title