Property Summary

NCBI Gene PubMed Count 65
PubMed Score 105.54
PubTator Score 187.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
breast carcinoma 1614 6.6e-04
astrocytic glioma 2241 3.7e-03
oligodendroglioma 2849 4.1e-03

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytic glioma -1.300 3.7e-03
oligodendroglioma -1.200 4.1e-03
breast carcinoma 1.100 6.6e-04

Protein-protein Interaction (6)

Gene RIF (38)

PMID Text
26450788 Our findings support the notion that epigenetic regulators, such as RNF2, directly and functionally control powerful gene networks that are vital in multiple cancer processes.
26151332 The enzymatic activity of BMI1 and RING1B were evaluated and compared.
26100231 O-GlcNAc modifies and regulates an essential epigenetic tool, RING1B, which may contribute to human embryonic stem cells pluripotency maintenance and differentiation.
25451922 BAP1 deficiency causes increased expression of FoxK2 target genes in a Ring1B-Bmi1-dependent manner
25431952 combinatorial silencing along with Ezh2 depleted epigenetically modified H2- and H3-histones and inhibited pancreatic cancer cell growth in vitro and in vivo (xenograft model)
24903147 Ring1B and the SNAG-associated chromatin modifier EZH2 formed distinct protein complexes with Snail and that EZH2 was required for Snail-Ring1A/B recruitment to the target promoter.
24813883 Authors describe a critical role for the polycomb group protein Ring1b in nonhomologous end-joining (NHEJ)-mediated end-to-end chromosome fusions.
24796740 Data indicate that RING finger protein 2 (RNF2) knockdown can increase the sensitivity of U87 cells to X ray radiation.
24742605 we identify p63 as a target of Ring1B to regulate Fak expression in breast cancer epithelial cells
24614341 Bmi1 and possibly RNF2 may be attractive biomarkers of gemcitabine resistance in the context of RRM1 expression.
24603765 The acidic patch functions within the nucleosome as nucleosomes containing a mutated acidic patch exhibit defective H2A/H2AXub by RNF168 and RING1B/BMI1 in vitro
24284202 Expressed the isolated N-terminal region of Ring1B, N-Ring1B, comprising the first 221 residues of the 334-residue-long Ring1B and found that the N-Ring1B is a well-folded, monomeric fragment, with native-like structure which unfolds irreversibly.
23955241 Phosphorylated DING (pDING) inhibits HIV-1 Tat-induced neuronal cell injury by suppressing the activity of serine/threonine kinases p38 MAPK and Cdk5 and enhancing the activity of neuroprotective factor MEF2 through the phosphotase activity of pDING
23727134 BMI-1 and RING1B expression was enhanced with the development of embryos in early pregnancy.
23712474 Ring2 may effect the DNA repair through other pathways but not through the expressions of NER protein.
23319651 Results indicate that RNF2 is an E3 ligase for p53 degradation in selective cells, implicating RNF2 as a therapeutic target to restore tumor suppression through p53 in certain tumor cells.
23318437 knockdown of RNF2 significantly inhibits both cell proliferation and colony formation and induces apoptosis in cancer cells
22427948 The organism reacts to HIV-infection by an overexpression of DING proteins.
22042911 These data provide evidence that the X-DING-CD4 gene contributes to early cellular protection from HIV infection in some individuals and this protection depends solely on the unique genetic regulation of the host.
22031506 the reduction of LPS-mediated IL-8 promoter activation was not related to de novo X-DING-CD4 protein synthesis, but depended on function of the exogenous X-DING-CD4 protein.
21772249 Crystallography of a complex of the Bmi1/Ring1b RING-RING heterodimer & UbcH5c shows that UbcH5c interacts with Ring1b only. Bmi1/Ring1b interacts with nucleosomal DNA & an acidic patch on histone H4 to achieve specific monoubiquitination of H2A.
21347701 identification of genes regulated by ring finger protein 2
20696397 Polycomb Group protein targeting to different chromatin locations relies, in part, on binding partners of the C-terminal domain of RING1B that are diverse in sequence and structure.
20351251 polycomb protein Ring1B regulation by self-ubiquitination or by E6-AP may have implications to the pathogenesis of Angelman syndrome
20237291 Ring1B plays an important role in the induction of T helper (Th)2 cell-driven allergic airway inflammation through the control of Bim-dependent apoptosis of effector T helper (Th)2 cells in vivo.
19584075 Observational study of gene-disease association. (HuGE Navigator)
19412891 Studies in mammalian cells have found a multiplicity of protein complexes containing Ring1A and Ring1B, suggesting an expanded regulatory role for Ring1A, Ring1B proteins in the epigenetic regulation of gene expression.
18629613 a novel mechanism by which RNF2 and PHB2 modulate the CP2-mediated transcriptional pathway.
18616292 Data show that the presence of flexible regions could allow C-terminal region of RING1B to bind a variety of different factors, ultimately recruiting RING1B and its associated PcG proteins to different genomic loci.
18051367 Phosphorylated DING (pDING) inhibits HIV-1 Tat-induced neuronal cell injury by suppressing the activity of serine/threonine kinases p38 MAPK and Cdk5 and enhancing the activity of neuroprotective factor MEF2 through the phosphotase activity of pDING
17936708 Results show that a phosphorylated form of Mel-18 targets the Ring1B histone H2A ubiquitin ligase to chromatin.
17873902 With prohibitin, regulates the activity of E2F1 transcription factor via dual pathways.
17379327 caspases-3 and caspase-9 play novel roles in transcription by regulating polycomb protein function through direct cleaving of Ring1B.
17157253 Ring1B and Bmi1 are degraded by an exogenous E3, independent of their RING domain. The RING domains of both proteins mediate their association and subsequent stabilization.
16714294 Bmi-1-Ring1B complex stabilizes the interaction of the ubiquitin ligase complex.
15931389 Altered mRNA expression is associated with therapy failure and death in patients with multiple types of cancer.
15773819 The E3 ubiquitin ligase RNF2 might have a dual function: facilitating the ubiquitination of its target substrates and recruiting the substrates to the proteasome.
11865070 The human PcG protein dinG interacts with CP2, a mammalian member of the grainyhead-like family of transcription factors, in vitro and in vivo. The functional consequence of this interaction is repression of CP2-dependent transcription.

AA Sequence

MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHR      1 - 70
FCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQAL     71 - 140
SHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNN    141 - 210
NAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQ    211 - 280
MNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK                  281 - 336
//

Text Mined References (70)

PMID Year Title
26687479 2015 The variant Polycomb Repressor Complex 1 component PCGF1 interacts with a pluripotency sub-network that includes DPPA4, a regulator of embryogenesis.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26450788 2015 Dual Roles of RNF2 in Melanoma Progression.
26151332 2015 BMI1-RING1B is an autoinhibited RING E3 ubiquitin ligase.
26100231 2015 RING1B O-GlcNAcylation regulates gene targeting of polycomb repressive complex 1 in human embryonic stem cells.
25519132 2014 An AUTS2-Polycomb complex activates gene expression in the CNS.
25451922 2015 BRCA1-associated protein 1 (BAP1) deubiquitinase antagonizes the ubiquitin-mediated activation of FoxK2 target genes.
25431952 2014 H2AK119Ub1 and H3K27Me3 in molecular staging for survival prediction of patients with pancreatic ductal adenocarcinoma.
24903147 2014 Snail recruits Ring1B to mediate transcriptional repression and cell migration in pancreatic cancer cells.
24813883 2014 Isolation of chromatin from dysfunctional telomeres reveals an important role for Ring1b in NHEJ-mediated chromosome fusions.
24796740 2014 [Effect of RNF2 knockdown on apoptosis and radiosensitivity in glioma U87 cells].
24742605 2014 The Polycomb group protein RING1B is overexpressed in ductal breast carcinoma and is required to sustain FAK steady state levels in breast cancer epithelial cells.
24614341 2014 Ubiquitination and degradation of ribonucleotide reductase M1 by the polycomb group proteins RNF2 and Bmi1 and cellular response to gemcitabine.
24603765 2014 Nucleosome acidic patch promotes RNF168- and RING1B/BMI1-dependent H2AX and H2A ubiquitination and DNA damage signaling.
24284202 2014 The isolated N terminus of Ring1B is a well-folded, monomeric fragment with native-like structure.
23727134 2013 The dynamics of polycomb group proteins in early embryonic nervous system in mouse and human.
23712474 2013 Role of ubiquitin protein ligase Ring2 in DNA damage of human bronchial epithelial cells exposed to benzo[a]pyrene.
23319651 2013 RNF2/Ring1b negatively regulates p53 expression in selective cancer cell types to promote tumor development.
23318437 2014 Knockdown of RNF2 induces apoptosis by regulating MDM2 and p53 stability.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22493164 2012 Systematic analysis of dimeric E3-RING interactions reveals increased combinatorial complexity in human ubiquitination networks.
22427948 2012 The level of DING proteins is increased in HIV-infected patients: in vitro and in vivo studies.
22042911 2012 Cellular resistance to HIV-1 infection in target cells coincides with a rapid induction of X-DING-CD4 mRNA: indication of the unique host innate response to virus regulated through function of the X-DING-CD4 gene.
22031506 2012 Native X-DING-CD4 protein secreted by HIV-1 resistant CD4+ T cells blocks activity of IL-8 promoter in human endothelial cells infected with enteric bacteria.
21772249 2011 Recognition of UbcH5c and the nucleosome by the Bmi1/Ring1b ubiquitin ligase complex.
21347701 2011 Identification and characterization of RNF2 response elements in human kidney cells.
21282530 2011 Interaction proteomics analysis of polycomb proteins defines distinct PRC1 complexes in mammalian cells.
21269460 2011 Initial characterization of the human central proteome.
20696397 2010 Polycomb group targeting through different binding partners of RING1B C-terminal domain.
20601937 2010 Ubiquitin-specific proteases 7 and 11 modulate Polycomb regulation of the INK4a tumour suppressor.
20351251 2010 Regulation of the polycomb protein Ring1B by self-ubiquitination or by E6-AP may have implications to the pathogenesis of Angelman syndrome.
20237291 2010 Polycomb group gene product Ring1B regulates Th2-driven airway inflammation through the inhibition of Bim-mediated apoptosis of effector Th2 cells in the lung.
19791798 2009 Ring1B contains a ubiquitin-like docking module for interaction with Cbx proteins.
19636380 2009 Several distinct polycomb complexes regulate and co-localize on the INK4a tumor suppressor locus.
19584075 2009 Novel susceptibility loci for second primary tumors/recurrence in head and neck cancer patients: large-scale evaluation of genetic variants.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19412891 2009 Role of polycomb proteins Ring1A and Ring1B in the epigenetic regulation of gene expression.
18629613 2008 PHB2 interacts with RNF2 and represses CP2c-stimulated transcription.
18616292 2008 Structural transitions of the RING1B C-terminal region upon binding the polycomb cbox domain.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17936708 2007 A phosphorylated form of Mel-18 targets the Ring1B histone H2A ubiquitin ligase to chromatin.
17873902 2008 Prohibitin interacts with RNF2 and regulates E2F1 function via dual pathways.
17379327 2007 Polycomb group protein RING1B is a direct substrate of Caspases-3 and -9.
17332741 2007 Bypass of senescence by the polycomb group protein CBX8 through direct binding to the INK4A-ARF locus.
17157253 2006 The polycomb protein Ring1B generates self atypical mixed ubiquitin chains required for its in vitro histone H2A ligase activity.
17088979 2006 RNF2 interacts with the linker region of the human P-glycoprotein.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16943429 2006 Polycomb group and SCF ubiquitin ligases are found in a novel BCOR complex that is recruited to BCL6 targets.
16714294 2006 Structure of a Bmi-1-Ring1B polycomb group ubiquitin ligase complex.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16710298 2006 Structure and E3-ligase activity of the Ring-Ring complex of polycomb proteins Bmi1 and Ring1b.
16359901 2005 Role of Bmi-1 and Ring1A in H2A ubiquitylation and Hox gene silencing.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15960975 2005 Physical association and coordinate function of the H3 K4 methyltransferase MLL1 and the H4 K16 acetyltransferase MOF.
15931389 2005 Microarray analysis identifies a death-from-cancer signature predicting therapy failure in patients with multiple types of cancer.
15773819 2005 E3 ubiquitin ligase RNF2 interacts with the S6' proteasomal ATPase subunit and increases the ATP hydrolysis activity of S6'.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15386022 2004 Role of histone H2A ubiquitination in Polycomb silencing.
15009096 2004 Proteomics analysis of the centromere complex from HeLa interphase cells: UV-damaged DNA binding protein 1 (DDB-1) is a component of the CEN-complex, while BMI-1 is transiently co-localized with the centromeric region in interphase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12589020 2003 Rnf2 (Ring1b) deficiency causes gastrulation arrest and cell cycle inhibition.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12183370 2002 Involvement of the Polycomb-group gene Ring1B in the specification of the anterior-posterior axis in mice.
12167701 2002 The core of the polycomb repressive complex is compositionally and functionally conserved in flies and humans.
12004135 2002 A complex with chromatin modifiers that occupies E2F- and Myc-responsive genes in G0 cells.
11865070 2002 Binding of the RING polycomb proteins to specific target genes in complex with the grainyhead-like family of developmental transcription factors.
11513855 2001 E3 ligase activity of RING finger proteins that interact with Hip-2, a human ubiquitin-conjugating enzyme.
10369680 1999 RYBP, a new repressor protein that interacts with components of the mammalian Polycomb complex, and with the transcription factor YY1.