Property Summary

NCBI Gene PubMed Count 18
PubMed Score 15.54
PubTator Score 9.17

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.166 1.9e-05
astrocytic glioma 1.500 1.5e-02
ependymoma 1.800 4.6e-03
invasive ductal carcinoma 1.100 9.7e-03
juvenile dermatomyositis 1.183 2.0e-09
medulloblastoma, large-cell -1.400 4.5e-03
oligodendroglioma 1.200 2.7e-02
osteosarcoma 1.115 1.2e-02
ovarian cancer 1.600 4.9e-03
psoriasis -1.400 1.2e-04

Gene RIF (9)

AA Sequence

MQEQEIGFISKYNEGLCVNTDPVSILTSILDMSLHRQMGSDRDLQSSASSVSLPSVKKAPKKRRISIGSL      1 - 70
FRRKKDNKRKSRELNGGVDGIASIESIHSEMCTDKNSIFSTNTSSDNGLTSISKQIGDFIECPLCLLRHS     71 - 140
KDRFPDIMTCHHRSCVDCLRQYLRIEISESRVNISCPECTERFNPHDIRLILSDDVLMEKYEEFMLRRWL    141 - 210
VADPDCRWCPAPDCGYAVIAFGCASCPKLTCGREGCGTEFCYHCKQIWHPNQTCDAARQERAQSLRLRTI    211 - 280
RSSSISYSQESGAAADDIKPCPRCAAYIIKMNDGSCNHMTCAVCGCEFCWLCMKEISDLHYLSPSGCTFW    281 - 350
GKKPWSRKKKILWQLGTLVGAPVGIALIAGIAIPAMIIGIPVYVGRKIHNRYEGKDVSKHKRNLAIAGGV    351 - 420
TLSVIVSPVVAAVTVGIGVPIMLAYVYGVVPISLCRSGGCGVSAGNGKGVRIEFDDENDINVGGTNTAVD    421 - 490
TTSVAEARHNPSIGEGSVGGLTGSLSASGSHMDRIGAIRDNLSETASTMALAGASITGSLSGSAMVNCFN    491 - 560
RLEVQADVQKERYSLSGESGTVSLGTVSDNASTKAMAGSILNSYIPLDKEGNSMEVQVDIESKPSKFRHN    561 - 630
SGSSSVDDGSATRSHAGGSSSGLPEGKSSATKWSKEATAGKKSKSGKLRKKGNMKINETREDMDAQLLEQ    631 - 700
QSTNSSEFEAPSLSDSMPSVADSHSSHFSEFSCSDLESMKTSCSHGSSDYHTRFATVNILPEVENDRLEN    701 - 770
SPHQCSISVVTQTASCSEVSQLNHIAEEHGNNGIKPNVDLYFGDALKETNNNHSHQTMELKVAIQTEI      771 - 838
//

Text Mined References (22)

PMID Year Title