Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.57
PubTator Score 2.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
nephrosclerosis -1.361 1.9e-02
primary pancreatic ductal adenocarcinoma -1.340 6.7e-03
intraductal papillary-mucinous adenoma (... -2.100 1.3e-03
intraductal papillary-mucinous carcinoma... -1.500 2.4e-02
colon cancer -1.800 1.7e-04
diabetes mellitus 1.300 2.2e-03
inflammatory breast cancer -1.300 4.3e-05
pancreatic cancer -1.300 9.6e-03

Gene RIF (3)

PMID Text
24068945 Our results confirmed significant association to rare non-synonymous coding variants in both IL23R and CARD9, previously identified from sequencing of CD loci, as well as identified a novel association in RNF186
23896122 BNip1 functions as a downstream modulator of RNF186 to direct endoplasmic reticulum stress-associated apoptotic signaling.
23511034 Single-nucleotide polymorphism in RNF186 gene is associated with ulcerative colitis.

AA Sequence

MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCPRLPKLLACQHAFCAICLKLL      1 - 70
LCVQDNTWSITCPLCRKVTAVPGGLICSLRDHEAVVGQLAQPCTEVSLCPQGLVDPADLAAGHPSLVGED     71 - 140
GQDEVSANHVAARRLAAHLLLLALLIILIGPFIYPGVLRWVLTFIIALALLMSTLFCCLPSTRGSCWPSS    141 - 210
RTLFCREQKHSHISSIA                                                         211 - 227
//

Text Mined References (10)

PMID Year Title
24068945 2013 Deep resequencing of GWAS loci identifies rare variants in CARD9, IL23R and RNF186 that are associated with ulcerative colitis.
23896122 2013 A novel RING finger E3 ligase RNF186 regulate ER stress-mediated apoptosis through interaction with BNip1.
23511034 2013 Genome-wide association study of ulcerative colitis in Koreans suggests extensive overlapping of genetic susceptibility with Caucasians.
20228799 2010 Genome-wide association identifies multiple ulcerative colitis susceptibility loci.
19122664 2009 Ulcerative colitis-risk loci on chromosomes 1p36 and 12q15 found by genome-wide association study.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.