Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.34
PubTator Score 2.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.100 3.2e-03
pancreatic ductal adenocarcinoma liver m... -1.021 2.3e-03

Protein-protein Interaction (8)

Gene RIF (5)

AA Sequence

MASKGPSASASPENSSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETR      1 - 70
PNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGFQGFGFGDGGFQMSFGIG     71 - 140
AFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLFVALVIMFWLLIA                      141 - 192
//

Text Mined References (13)

PMID Year Title