Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.68
PubTator Score 0.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (1)

AA Sequence

MAEQQGRELEAECPVCWNPFNNTFHTPKMLDCCHSFCVECLAHLSLVTPARRRLLCPLCRQPTVLASGQP      1 - 70
VTDLPTDTAMLALLRLEPHHVILEGHQLCLKDQPKSRYFLRQPQVYTLDLGPQPGGQTGPPPDTASATVS     71 - 140
TPILIPSHHSLRECFRNPQFRIFAYLMAVILSVTLLLIFSIFWTKQFLWGVG                      141 - 192
//

Text Mined References (8)

PMID Year Title