Property Summary

NCBI Gene PubMed Count 14
PubMed Score 9.98
PubTator Score 7.78

Knowledge Summary


No data available


  Differential Expression (20)

Disease log2 FC p
oligodendroglioma 2.000 3.5e-02
astrocytoma 1.400 1.4e-11
glioblastoma 1.900 4.1e-06
osteosarcoma -1.228 4.5e-02
ependymoma 1.200 3.4e-05
atypical teratoid / rhabdoid tumor -1.800 2.3e-02
medulloblastoma, large-cell -2.900 2.2e-05
primitive neuroectodermal tumor 1.300 1.8e-02
intraductal papillary-mucinous carcinoma... -2.000 5.0e-04
intraductal papillary-mucinous neoplasm ... -1.600 2.6e-02
Breast cancer -2.500 3.0e-24
interstitial cystitis -1.200 1.1e-02
lung adenocarcinoma -1.500 1.3e-13
pediatric high grade glioma 1.600 4.2e-06
group 3 medulloblastoma -1.200 4.3e-02
pilocytic astrocytoma 1.800 5.9e-06
ductal carcinoma in situ -1.100 2.1e-03
invasive ductal carcinoma -1.400 5.7e-03
ovarian cancer -1.100 1.7e-03
pituitary cancer 1.500 1.4e-05

Gene RIF (6)

26805552 RNF180 is capable of inhibiting lymph node metastasis of gastric cancer by suppressing the intracellular activation of malignant molecular signals.
25769451 hypermethylated CpG site count of E3 ubiquitin ligase Ring finger protein 180 promoter for evaluating the prognosis of gastric cancer was reasonable by using the direct bisulfite sequencing.
24833402 We found that only few methylated CpG sites of RNF180 promoter was appropriate to predict the survival of gastric cancer
22563461 Data indicate that the ring finger protein 180 (RNF180) and HTR1A showed association to T1D in the Swedish and Danish families.
21717426 RNF180 is a novel potential tumor suppressor in gastric carcinogenesis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

FDMDMVIIYIYSVNWVIGFIVFCFLCYFFFPF                                          561 - 592

Text Mined References (15)

PMID Year Title
26805552 2016 Clinical and experimental role of ring finger protein 180 on lymph node metastasis and survival in gastric cancer.
25769451 2015 Evaluating the clinical feasibility: The direct bisulfite genomic sequencing for examination of methylated status of E3 ubiquitin ligase RNF180 DNA promoter to predict the survival of gastric cancer.
24833402 2014 Methylation of CpG sites in RNF180 DNA promoter prediction poor survival of gastric cancer.
22563461 2012 HTR1A a novel type 1 diabetes susceptibility gene on chromosome 5p13-q13.
21717426 2012 Characterization of the gene structure, functional significance, and clinical application of RNF180, a novel gene in gastric cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.