| Tbio | E3 ubiquitin-protein ligase RNF180 |
E3 ubiquitin-protein ligase which promotes polyubiquitination and degradation by the proteasome pathway of ZIC2.
Comments
| Disease | Target Count | P-value |
|---|---|---|
| Breast cancer | 3098 | 3.0e-24 |
| lung adenocarcinoma | 2714 | 1.3e-13 |
| astrocytoma | 1493 | 1.4e-11 |
| glioblastoma | 5572 | 4.1e-06 |
| pediatric high grade glioma | 2712 | 4.2e-06 |
| pilocytic astrocytoma | 3086 | 5.9e-06 |
| pituitary cancer | 1972 | 1.4e-05 |
| medulloblastoma, large-cell | 6234 | 2.2e-05 |
| ependymoma | 2514 | 3.4e-05 |
| intraductal papillary-mucinous carcinoma (IPMC) | 2988 | 5.0e-04 |
| ovarian cancer | 8491 | 1.7e-03 |
| ductal carcinoma in situ | 1745 | 2.1e-03 |
| invasive ductal carcinoma | 2950 | 5.7e-03 |
| interstitial cystitis | 2299 | 1.1e-02 |
| primitive neuroectodermal tumor | 3031 | 1.8e-02 |
| atypical teratoid / rhabdoid tumor | 4369 | 2.3e-02 |
| intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 2.6e-02 |
| oligodendroglioma | 2849 | 3.5e-02 |
| group 3 medulloblastoma | 2254 | 4.3e-02 |
| osteosarcoma | 7933 | 4.5e-02 |
| Disease | log2 FC | p |
|---|---|---|
| oligodendroglioma | 2.000 | 3.5e-02 |
| astrocytoma | 1.400 | 1.4e-11 |
| glioblastoma | 1.900 | 4.1e-06 |
| osteosarcoma | -1.228 | 4.5e-02 |
| ependymoma | 1.200 | 3.4e-05 |
| atypical teratoid / rhabdoid tumor | -1.800 | 2.3e-02 |
| medulloblastoma, large-cell | -2.900 | 2.2e-05 |
| primitive neuroectodermal tumor | 1.300 | 1.8e-02 |
| intraductal papillary-mucinous carcinoma... | -2.000 | 5.0e-04 |
| intraductal papillary-mucinous neoplasm ... | -1.600 | 2.6e-02 |
| Breast cancer | -2.500 | 3.0e-24 |
| interstitial cystitis | -1.200 | 1.1e-02 |
| lung adenocarcinoma | -1.500 | 1.3e-13 |
| pediatric high grade glioma | 1.600 | 4.2e-06 |
| group 3 medulloblastoma | -1.200 | 4.3e-02 |
| pilocytic astrocytoma | 1.800 | 5.9e-06 |
| ductal carcinoma in situ | -1.100 | 2.1e-03 |
| invasive ductal carcinoma | -1.400 | 5.7e-03 |
| ovarian cancer | -1.100 | 1.7e-03 |
| pituitary cancer | 1.500 | 1.4e-05 |
| PMID | Text | |
|---|---|---|
| 26805552 | RNF180 is capable of inhibiting lymph node metastasis of gastric cancer by suppressing the intracellular activation of malignant molecular signals. | |
| 25769451 | hypermethylated CpG site count of E3 ubiquitin ligase Ring finger protein 180 promoter for evaluating the prognosis of gastric cancer was reasonable by using the direct bisulfite sequencing. | |
| 24833402 | We found that only few methylated CpG sites of RNF180 promoter was appropriate to predict the survival of gastric cancer | |
| 22563461 | Data indicate that the ring finger protein 180 (RNF180) and HTR1A showed association to T1D in the Swedish and Danish families. | |
| 21717426 | RNF180 is a novel potential tumor suppressor in gastric carcinogenesis. | |
| 20379614 | Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) |
MKRSKELITKNHSQEETSILRCWKCRKCIASSGCFMEYLENQVIKDKDDSVDAQNICHVWHMNVEALPEW 1 - 70 ISCLIQKAQWTVGKLNCPFCGARLGGFNFVSTPKCSCGQLAAVHLSKSRTDYQPTQAGRLMRPSVKYLSH 71 - 140 PRVQSGCDKEALLTGGGSENRNHRLLNMARNNNDPGRLTEALCLEVRPTYFEMKNEKLLSKASEPKYQLF 141 - 210 VPQLVTGRCATRAFHRKSHSLDLNISEKLTLLPTLYEIHSKTTAYSRLNETQPIDLSGLPLQSSKNSYSF 211 - 280 QNPSSFDPSMLLQRFSVAPHETQTQRGGEFQCGLEAASVYSDHTNTNNLTFLMDLPSAGRSMPEASDQEE 281 - 350 HLSPLDFLHSANFSLGSINQRLNKRERSKLKNLRRKQRRRERWLQKQGKYSGVGLLDHMTLNNEMSTDED 351 - 420 NEYAEEKDSYICAVCLDVYFNPYMCYPCHHIFCEPCLRTLAKDNPSSTPCPLCRTIISRVFFQTELNNAT 421 - 490 KTFFTKEYLKIKQSFQKSNSAKWPLPSCRKAFHLFGGFRRHAAPVTRRQFPHGAHRMDYLHFEDDSRGWW 491 - 560 FDMDMVIIYIYSVNWVIGFIVFCFLCYFFFPF 561 - 592 //
| PMID | Year | Title | |
|---|---|---|---|
| 26805552 | 2016 | Clinical and experimental role of ring finger protein 180 on lymph node metastasis and survival in gastric cancer. | |
| 25769451 | 2015 | Evaluating the clinical feasibility: The direct bisulfite genomic sequencing for examination of methylated status of E3 ubiquitin ligase RNF180 DNA promoter to predict the survival of gastric cancer. | |
| 24833402 | 2014 | Methylation of CpG sites in RNF180 DNA promoter prediction poor survival of gastric cancer. | |
| 22563461 | 2012 | HTR1A a novel type 1 diabetes susceptibility gene on chromosome 5p13-q13. | |
| 21717426 | 2012 | Characterization of the gene structure, functional significance, and clinical application of RNF180, a novel gene in gastric cancer. | |
| 20379614 | Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. | ||
| 17974005 | 2007 | The full-ORF clone resource of the German cDNA Consortium. | |
| 16381901 | 2006 | The LIFEdb database in 2006. | |
| 16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. | |
| 15489336 | 2004 | From ORFeome to biology: a functional genomics pipeline. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 11230166 | 2001 | Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. | |
| 11076863 | 2000 | DNA cloning using in vitro site-specific recombination. |
