Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -2.100 1.6e-04
astrocytic glioma -2.500 5.8e-03
atypical teratoid / rhabdoid tumor -2.700 3.8e-04
ependymoma -1.200 1.2e-02
glioblastoma -1.600 9.8e-04
group 3 medulloblastoma -3.400 1.1e-05
head and neck cancer and chronic obstruc... -1.500 1.3e-04
medulloblastoma, large-cell -4.500 4.2e-08
oligodendroglioma -2.300 4.5e-03
osteosarcoma -2.343 1.1e-02
Pick disease -1.400 3.1e-03
primitive neuroectodermal tumor -2.300 1.5e-02

Gene RIF (4)

AA Sequence

MAAGTAARKAAPVLEAPPQQEQLSHTKLSAEDTWNLQQERMYKMHRGHDSMHVEMILIFLCVLVIAQIVL      1 - 70
VQWRQRHGRSYNLVTLLQMWVVPLYFTIKLYWWRFLSMWGMFSVITSYILFRATRKPLSGRTPRLVYKWF     71 - 140
LLIYKLSYAFGVVGYLAIMFTMCGFNLFFKIKARDSMDFGIVSLFYGLYYGVMGRDFAEICSDYMASTIG    141 - 210
FYSVSRLPTRSLSDNICAVCGQKIIVELDEEGLIENTYQLSCNHVFHEFCIRGWCIVGKKQTCPYCKEKV    211 - 280
DLKRMISNPWERTHFLYGQILDWLRYLVAWQPVVIGIVQGIIYSLGLE                          281 - 328
//

Text Mined References (11)

PMID Year Title