Property Summary

NCBI Gene PubMed Count 12
PubMed Score 75.28
PubTator Score 6.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma -1.200 1.0e-04
intraductal papillary-mucinous neoplasm ... 1.400 2.9e-03
medulloblastoma, large-cell -1.100 3.3e-04
osteosarcoma 1.290 1.7e-05
ovarian cancer -1.100 1.6e-04

Gene RIF (4)

AA Sequence

MAKYQGEVQSLKLDDDSVIEGVSDQVLVAVVVSFALIATLVYALFRNVHQNIHPENQELVRVLREQLQTE      1 - 70
QDAPAATRQQFYTDMYCPICLHQASFPVETNCGHLFCGACIIAYWRYGSWLGAISCPICRQTVTLLLTVF     71 - 140
GEDDQSQDVLRLHQDINDYNRRFSGQPRSIMERIMDLPTLLRHAFREMFSVGGLFWMFRIRIILCLMGAF    141 - 210
FYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVITQRLTR                          211 - 258
//

Text Mined References (14)

PMID Year Title