Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.08
PubTator Score 2.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8297 1.5e-06
osteosarcoma 7766 1.3e-05
spina bifida 1053 4.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Disease Target Count Z-score Confidence
Hepatoblastoma 19 3.106 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.230 1.3e-05
ovarian cancer -1.100 1.5e-06
spina bifida -1.312 4.7e-02

Gene RIF (4)

AA Sequence

MAAAGPSTRASSAAAAAALSRRGRRGRCDETAAAKTGAPGPASGPSLLVLSPPLLQPPLPPRPEESGCAG      1 - 70
CLEPPGEAAALPCGHSLCRGCAQRAADAAGPGCPRCRARGPGWARRRARDDGQADSEVLGECARRSQPER     71 - 140
CRPRRDGGAAAAGPRPEQEPRAAPAEPDFIFRAPIKLSKPGELREEYESLRKLREEKLQEEKPSEDQIHK    141 - 210
LLPEDTETGKRKMDEQKKRDEPLVLKTNLERCPARLSDSENEEPSRGQMTQTHRSAFVSKNNSYSLAFLA    211 - 280
GKLNSKVERSQSCSDTAQERAKSRVRAVPGNKAKVTTMTPASNPIIGVLLSTQNNRCVSAPDLTIEKRLP    281 - 350
FSSLSSLASLHKPERSVSPESNDSISEELNHFKPIVCSPCTPPKRLPDGRVLSPLIIKSTPRNLNRSLQK    351 - 420
QTSYEASPRILKKWEQIFQERQIKKTLSKATLTSLAPEMGEELLGSEGIHSSKEKPLVAVNTRLSGGQVL    421 - 490
SEYTGPTSADLDHFPSVSQTKAEQDSDNKSSTEIPLETCCSSELKGGGSGTSLEREQFEGLGSTPDAKLD    491 - 560
KTCISRAMKITTVNSVLPQNSVLGGVLKTKQQLKTLNHFDLTNGVLVESLSEEPLPSLRRGRKRHCKTKH    561 - 630
LEQNGSLKKLRQTSGEVGLAPTDPVLREMEQKLQQEEEDRQLALQLQRMFDNERRTVSRRKGSVDQYLLR    631 - 700
SSNMAGAK                                                                  701 - 708
//

Text Mined References (19)

PMID Year Title