Property Summary

NCBI Gene PubMed Count 50
PubMed Score 33.44
PubTator Score 52.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Riddle Syndrome 1 0.0 0.0
Disease Target Count P-value
osteosarcoma 7766 9.3e-09
ovarian cancer 8297 4.7e-03
hereditary spastic paraplegia 313 7.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7

Expression

  Differential Expression (3)

Disease log2 FC p
hereditary spastic paraplegia -1.032 7.2e-03
osteosarcoma -1.558 9.3e-09
ovarian cancer -1.100 4.7e-03

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (36)

AA Sequence

MALPKDAIPSLSECQCGICMEILVEPVTLPCNHTLCKPCFQSTVEKASLCCPFCRRRVSSWTRYHTRRNS      1 - 70
LVNVELWTIIQKHYPRECKLRASGQESEEVADDYQPVRLLSKPGELRREYEEEISKVAAERRASEEEENK     71 - 140
ASEEYIQRLLAEEEEEEKRQAEKRRRAMEEQLKSDEELARKLSIDINNFCEGSISASPLNSRKSDPVTPK    141 - 210
SEKKSKNKQRNTGDIQKYLTPKSQFGSASHSEAVQEVRKDSVSKDIDSSDRKSPTGQDTEIEDMPTLSPQ    211 - 280
ISLGVGEQGADSSIESPMPWLCACGAEWYHEGNVKTRPSNHGKELCVLSHERPKTRVPYSKETAVMPCGR    281 - 350
TESGCAPTSGVTQTNGNNTGETENEESCLLISKEISKRKNQESSFEAVKDPCFSAKRRKVSPESSPDQEE    351 - 420
TEINFTQKLIDLEHLLFERHKQEEQDRLLALQLQKEVDKEQMVPNRQKGSPDEYHLRATSSPPDKVLNGQ    421 - 490
RKNPKDGNFKRQTHTKHPTPERGSRDKNRQVSLKMQLKQSVNRRKMPNSTRDHCKVSKSAHSLQPSISQK    491 - 560
SVFQMFQRCTK                                                               561 - 571
//

Text Mined References (55)

PMID Year Title