Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.92
PubTator Score 0.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Autism Spectrum Disorders 4
Disease Target Count P-value
osteosarcoma 7933 1.8e-04
adult high grade glioma 2148 6.9e-03

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.885 1.8e-04
adult high grade glioma 1.100 6.9e-03

Synonym

Accession Q96A37 B3KQ03 D3DX75 H3BTU8 Q96DM0
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
26456228 These findings suggest that RNF166 positively regulates RNA virus-triggered IFN-beta production by enhancing the ubiquitination of TRAF3 and TRAF6.

AA Sequence

MAMFRSLVASAQQRQPPAGPAGGDSGLEAQYTCPICLEVYHRPVAIGSCGHTFCGECLQPCLQVPSPLCP      1 - 70
LCRLPFDPKKVDKATHVEKQLSSYKAPCRGCNKKVTLAKMRVHISSCLKVQEQMANCPKFVPVVPTSQPI     71 - 140
PSNIPNRSTFACPYCGARNLDQQELVKHCVESHRSDPNRVVCPICSAMPWGDPSYKSANFLQHLLHRHKF    141 - 210
SYDTFVDYSIDEEAAFQAALALSLSEN                                               211 - 237
//

Text Mined References (7)

PMID Year Title
26456228 2015 Ring finger protein 166 potentiates RNA virus-induced interferon-? production via enhancing the ubiquitination of TRAF3 and TRAF6.
25534755 2015 A genome-wide association study of autism using the Simons Simplex Collection: Does reducing phenotypic heterogeneity in autism increase genetic homogeneity?
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.