Property Summary

NCBI Gene PubMed Count 22
PubMed Score 8.53
PubTator Score 14.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -2.300 4.7e-05
glioblastoma -1.200 9.2e-05
medulloblastoma, large-cell -1.700 7.5e-05
lung cancer -1.100 9.3e-04
adult high grade glioma -1.100 1.4e-02
group 4 medulloblastoma 1.100 7.2e-03
subependymal giant cell astrocytoma -2.523 1.7e-02
lung adenocarcinoma -1.100 9.3e-11
ovarian cancer -2.600 2.9e-09

 GWAS Trait (1)

Protein-protein Interaction (11)

Gene RIF (10)

PMID Text
25327252 the maintenance of unliganded RNF146 in an inactive state may serve to maintain the stability of the RNF146-TNKS complex, which in turn regulates the homeostasis of PARylation-dependent ubiquitination activity in the cell
24454854 RNF146 regulated the development and progression of NSCLC
22274711 RNF146/Iduna has been found to be implicated in neurodegenerative disease and cancer development. [Review]
22267412 the RNF146 WWE domain recognizes poly(ADP-ribose) (PAR) by interacting with iso-ADP-ribose (iso-ADPR), the smallest internal PAR structural unit containing the characteristic ribose-ribose glycosidic bond formed during poly(ADP-ribosyl)ation.
21825151 Iduna is a Poly(ADP-ribose)-dependent ubiquitin E3 ligase.
21799911 RNF146 RING-type ubiquitin E3 ligase as a positive regulator of Wnt signaling that operates with tankyrase to maintain low steady-state levels of Axin proteins
19517271 Mutations in the coding regions of the RNF146 and ECHDC1 genes do not contribute to the burden of inherited predisposition of breast cancer in Ashkenazi high risk women.
19517271 Observational study of gene-disease association. (HuGE Navigator)
18326623 Genome-wide association study of gene-disease association. (HuGE Navigator)
15813938 Dactylidin may function early in the progression of Alzheimer's disease.

AA Sequence

MMAGCGEIDHSINMLPTNRKANESCSNTAPSLTVPECAICLQTCVHPVSLPCKHVFCYLCVKGASWLGKR      1 - 70
CALCRQEIPEDFLDKPTLLSPEELKAASRGNGEYAWYYEGRNGWWQYDERTSRELEDAFSKGKKNTEMLI     71 - 140
AGFLYVADLENMVQYRRNEHGRRRKIKRDIIDIPKKGVAGLRLDCDANTVNLARESSADGADSVSAQSGA    141 - 210
SVQPLVSSVRPLTSVDGQLTSPATPSPDASTSLEDSFAHLQLSGDNTAERSHRGEGEEDHESPSSGRVPA    211 - 280
PDTSIEETESDASSDSEDVSAVVAQHSLTQQRLLVSNANQTVPDRSDRSGTDRSVAGGGTVSVSVRSRRP    281 - 350
DGQCTVTEV                                                                 351 - 359
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25327252 2015 Allosteric activation of the RNF146 ubiquitin ligase by a poly(ADP-ribosyl)ation signal.
24454854 2014 Overexpression of RNF146 in non-small cell lung cancer enhances proliferation and invasion of tumors through the Wnt/?-catenin signaling pathway.
22504418 2012 Common variants at 6q22 and 17q21 are associated with intracranial volume.
22274711 Ring finger protein 146/Iduna is a poly(ADP-ribose) polymer binding and PARsylation dependent E3 ubiquitin ligase.
22267412 2012 Recognition of the iso-ADP-ribose moiety in poly(ADP-ribose) by WWE domains suggests a general mechanism for poly(ADP-ribosyl)ation-dependent ubiquitination.
21825151 2011 Iduna is a poly(ADP-ribose) (PAR)-dependent E3 ubiquitin ligase that regulates DNA damage.
21799911 2011 Ubiquitin ligase RNF146 regulates tankyrase and Axin to promote Wnt signaling.
21602803 2011 Iduna protects the brain from glutamate excitotoxicity and stroke by interfering with poly(ADP-ribose) polymer-induced cell death.
21478859 2011 RNF146 is a poly(ADP-ribose)-directed E3 ligase that regulates axin degradation and Wnt signalling.
21445572 2011 Genetic polymorphisms and breast cancer risk: evidence from meta-analyses, pooled analyses, and genome-wide association studies.
19690183 2009 The 6q22.33 locus and breast cancer susceptibility.
19517271 2009 The RNF146 and ECHDC1 genes as candidates for inherited breast and ovarian cancer in Jewish Ashkenazi women.
18326623 2008 Genome-wide association study provides evidence for a breast cancer risk locus at 6q22.33.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15813938 2005 The novel cytosolic RING finger protein dactylidin is up-regulated in brains of patients with Alzheimer's disease.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.