Property Summary

NCBI Gene PubMed Count 22
PubMed Score 12.32
PubTator Score 14.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 3.0
Disease Target Count Z-score Confidence
Cherubism 13 3.119 1.6

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.100 1.4e-02
glioblastoma -1.200 9.2e-05
group 4 medulloblastoma 1.100 7.2e-03
lung adenocarcinoma -1.100 9.3e-11
lung cancer -1.100 9.3e-04
medulloblastoma, large-cell -1.200 2.7e-04
ovarian cancer -1.200 8.9e-08
psoriasis -2.300 4.7e-05
subependymal giant cell astrocytoma -2.523 1.7e-02

 GWAS Trait (1)

Protein-protein Interaction (8)

Gene RIF (10)

AA Sequence

MMAGCGEIDHSINMLPTNRKANESCSNTAPSLTVPECAICLQTCVHPVSLPCKHVFCYLCVKGASWLGKR      1 - 70
CALCRQEIPEDFLDKPTLLSPEELKAASRGNGEYAWYYEGRNGWWQYDERTSRELEDAFSKGKKNTEMLI     71 - 140
AGFLYVADLENMVQYRRNEHGRRRKIKRDIIDIPKKGVAGLRLDCDANTVNLARESSADGADSVSAQSGA    141 - 210
SVQPLVSSVRPLTSVDGQLTSPATPSPDASTSLEDSFAHLQLSGDNTAERSHRGEGEEDHESPSSGRVPA    211 - 280
PDTSIEETESDASSDSEDVSAVVAQHSLTQQRLLVSNANQTVPDRSDRSGTDRSVAGGGTVSVSVRSRRP    281 - 350
DGQCTVTEV                                                                 351 - 359
//

Text Mined References (25)

PMID Year Title