Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.91
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.033 2.0e-04
adult high grade glioma -1.300 4.6e-03
Breast cancer -2.500 8.8e-11
gastric carcinoma 1.400 2.7e-02
intraductal papillary-mucinous adenoma (... 1.500 3.1e-03
intraductal papillary-mucinous carcinoma... 1.300 7.3e-03
juvenile dermatomyositis 1.217 2.7e-10
medulloblastoma, large-cell -1.900 2.2e-03
osteosarcoma 2.960 1.2e-06
ovarian cancer -2.000 1.2e-05
pancreatic cancer 1.100 6.7e-04
pancreatic ductal adenocarcinoma liver m... 1.701 3.3e-02
progressive supranuclear palsy 1.200 1.1e-02
tuberculosis -1.500 1.4e-07
ulcerative colitis 1.700 2.6e-06

AA Sequence

MAAKEKLEAVLNVALRVPSIMLLDVLYRWDVSSFFQQIQRSSLSNNPLFQYKYLALNMHYVGYILSVVLL      1 - 70
TLPRQHLVQLYLYFLTALLLYAGHQISRDYVRSELEFAYEGPMYLEPLSMNRFTTALIGQLVVCTLCSCV     71 - 140
MKTKQIWLFSAHMLPLLARLCLVPLETIVIINKFAMIFTGLEVLYFLGSNLLVPYNLAKSAYRELVQVVE    141 - 210
VYGLLALGMSLWNQLVVPVLFMVFWLVLFALQIYSYFSTRDQPASRERLLFLFLTSIAECCSTPYSLLGL    211 - 280
VFTVSFVALGVLTLCKFYLQGYRAFMNDPAMNRGMTEGVTLLILAVQTGLIELQVVHRAFLLSIILFIVV    281 - 350
ASILQSMLEIADPIVLALGASRDKSLWKHFRAVSLCLFLLVFPAYMAYMICQFFHMDFWLLIIISSSILT    351 - 420
SLQVLGTLFIYVLFMVEEFRKEPVENMDDVIYYVNGTYRLLEFLVALCVVAYGVSETIFGEWTVMGSMII    421 - 490
FIHSYYNVWLRAQLGWKSFLLRRDAVNKIKSLPIATKEQLEKHNDICAICYQDMKSAVITPCSHFFHAGC    491 - 560
LKKWLYVQETCPLCHCHLKNSSQLPGLGTEPVLQPHAGAEQNVMFQEGTEPPGQEHTPGTRIQEGSRDNN    561 - 630
EYIARRPDNQEGAFDPKEYPHSAKDEAHPVESA                                         631 - 663
//

Text Mined References (7)

PMID Year Title