Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.09
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
osteosarcoma 2.960 1.2e-06
medulloblastoma, large-cell -1.900 2.2e-03
juvenile dermatomyositis 1.217 2.7e-10
acute quadriplegic myopathy 1.033 2.0e-04
primary pancreatic ductal adenocarcinoma 2.337 1.4e-04
tuberculosis -1.500 1.4e-07
intraductal papillary-mucinous adenoma (... 1.500 3.1e-03
intraductal papillary-mucinous carcinoma... 1.300 7.3e-03
pancreatic cancer 2.400 3.4e-04
adult high grade glioma -1.300 4.6e-03
progressive supranuclear palsy 1.200 1.1e-02
Breast cancer -2.500 8.8e-11
gastric carcinoma 1.400 2.7e-02
ulcerative colitis 1.800 1.2e-04
ovarian cancer 2.700 1.0e-05

AA Sequence

MAAKEKLEAVLNVALRVPSIMLLDVLYRWDVSSFFQQIQRSSLSNNPLFQYKYLALNMHYVGYILSVVLL      1 - 70
TLPRQHLVQLYLYFLTALLLYAGHQISRDYVRSELEFAYEGPMYLEPLSMNRFTTALIGQLVVCTLCSCV     71 - 140
MKTKQIWLFSAHMLPLLARLCLVPLETIVIINKFAMIFTGLEVLYFLGSNLLVPYNLAKSAYRELVQVVE    141 - 210
VYGLLALGMSLWNQLVVPVLFMVFWLVLFALQIYSYFSTRDQPASRERLLFLFLTSIAECCSTPYSLLGL    211 - 280
VFTVSFVALGVLTLCKFYLQGYRAFMNDPAMNRGMTEGVTLLILAVQTGLIELQVVHRAFLLSIILFIVV    281 - 350
ASILQSMLEIADPIVLALGASRDKSLWKHFRAVSLCLFLLVFPAYMAYMICQFFHMDFWLLIIISSSILT    351 - 420
SLQVLGTLFIYVLFMVEEFRKEPVENMDDVIYYVNGTYRLLEFLVALCVVAYGVSETIFGEWTVMGSMII    421 - 490
FIHSYYNVWLRAQLGWKSFLLRRDAVNKIKSLPIATKEQLEKHNDICAICYQDMKSAVITPCSHFFHAGC    491 - 560
LKKWLYVQETCPLCHCHLKNSSQLPGLGTEPVLQPHAGAEQNVMFQEGTEPPGQEHTPGTRIQEGSRDNN    561 - 630
EYIARRPDNQEGAFDPKEYPHSAKDEAHPVESA                                         631 - 663
//

Text Mined References (7)

PMID Year Title
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
19820697 2009 A genome-wide meta-analysis identifies 22 loci associated with eight hematological parameters in the HaemGen consortium.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.