Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.54
PubTator Score 2.28

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

AA Sequence

MTTTRYRPTWDLALDPLVSCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAAC      1 - 70
PKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDVGLQTPQPVQCKACRM     71 - 140
EFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDDAPIKRCPKCKVYIERDEGCAQMMCKNCKHAF    141 - 210
CWYCLESLDDDFLLIHYDKGPCRNKLGHSRASVIWHRTQVVGIFAGFGLLLLVASPFLLLATPFVLCCKC    211 - 280
KCSKGDDDPLPT                                                              281 - 292
//

Text Mined References (12)

PMID Year Title