Property Summary

NCBI Gene PubMed Count 21
PubMed Score 12.52
PubTator Score 13.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
aldosterone-producing adenoma -1.035 4.4e-02
astrocytic glioma -1.500 1.8e-02
atypical teratoid / rhabdoid tumor -1.200 4.4e-04
gastric cancer 1.100 2.6e-03
hepatocellular carcinoma 1.200 1.6e-05
medulloblastoma, large-cell -1.500 7.7e-04
ovarian cancer -1.100 2.8e-03

Gene RIF (7)

AA Sequence

MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNECLQNSGFEYTICFL      1 - 70
PPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGSVVLFAWMQFLKEETLAYLNI     71 - 140
VSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNLIQEILDFDQAQQI    141 - 210
KCFNSKLFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVK    211 - 280
ELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPC    281 - 350
KVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKLDGCNKM    351 - 420
TCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEVED                    421 - 474
//

Text Mined References (25)

PMID Year Title