Property Summary

NCBI Gene PubMed Count 16
PubMed Score 14.86
PubTator Score 16.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.432 4.7e-03
tuberculosis and treatment for 6 months 1.400 1.9e-06
ovarian cancer 1.200 9.1e-03

Protein-protein Interaction (6)

Gene RIF (7)

PMID Text
26210183 TRC8 and TMEM129 are endoplasmic reticulum-associated degradation ubiquitin E3 ligases for viral and cellular targeting of MHC class I. (Review)
22689053 TRC8 suppresses tumorigenesis through targeting heme oxygenase-1 for ubiquitination and degradation.
20068067 TRC8 function may provide a regulatory link between the lipid and protein biosynthetic pathways.
19720873 Data show that the TRC8 E3 ligase is required for MHC I dislocation from the ER and identify a new complex associated with mammalian ERAD.
19706601 TRC8 is a novel sterol-sensing endoplasmic reticulum membrane protein that hinders SREBP-2 processing through interaction with SREBP-2 and SCAP, regulating its own turnover rate by means of its E3 ubiquitin ligase activity
17539022 The presence of diploid and tetraploid tumor cells with and without TRC8 deletions on the nontranslocated chromosome suggest that loss of the remaining normal allele of TRC8 may contribute to tumor development at later stages.
17016439 TRC8 modulation of sterol response element binding protein activity comprises a novel regulatory link between growth control and the cholesterol/lipid homeostasis pathway.

AA Sequence

MAAVGPPQQQVRMAHQQVWAALEVALRVPCLYIIDAIFNSYPDSSQSRFCIVLQIFLRLFGVFASSIVLI      1 - 70
LSQRSLFKFYTYSSAFLLAATSVLVNYYASLHIDFYGAYNTSAFGIELLPRKGPSLWMALIVLQLTFGIG     71 - 140
YVTLLQIHSIYSQLIILDLLVPVIGLITELPLHIRETLLFTSSLILTLNTVFVLAVKLKWFYYSTRYVYL    141 - 210
LVRHMYRIYGLQLLMEDTWKRIRFPDILRVFWLTRVTAQATVLMYILRMANETDSFFISWDDFWDLICNL    211 - 280
IISGCDSTLTVLGMSAVISSVAHYLGLGILAFIGSTEEDDRRLGFVAPVLFFILALQTGLSGLRPEERLI    281 - 350
RLSRNMCLLLTAVLHFIHGMTDPVLMSLSASHVSSFRRHFPVLFVSACLFILPVLLSYVLWHHYALNTWL    351 - 420
FAVTAFCVELCLKVIVSLTVYTLFMIDGYYNVLWEKLDDYVYYVRSTGSIIEFIFGVVMFGNGAYTMMFE    421 - 490
SGSKIRAFMMCLHAYFNIYLQAKNGWKTFMNRRTAVKKINSLPEIKGSRLQEINDVCAICYHEFTTSARI    491 - 560
TPCNHYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSNNNGFIPPNETPEEAVREAAAESDRELN    561 - 630
EDDSTDCDDDVQRERNGVIQHTGAAAEEFNDDTD                                        631 - 664
//

Text Mined References (25)

PMID Year Title
26210183 2015 Identifying the ERAD ubiquitin E3 ligases for viral and cellular targeting of MHC class I.
25239945 2014 Signal peptide peptidase functions in ERAD to cleave the unfolded protein response regulator XBP1u.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22689053 2013 TRC8 suppresses tumorigenesis through targeting heme oxygenase-1 for ubiquitination and degradation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20068067 2010 The TRC8 ubiquitin ligase is sterol regulated and interacts with lipid and protein biosynthetic pathways.
19720873 2009 The TRC8 E3 ligase ubiquitinates MHC class I molecules before dislocation from the ER.
19706601 2009 The sterol-sensing endoplasmic reticulum (ER) membrane protein TRC8 hampers ER to Golgi transport of sterol regulatory element-binding protein-2 (SREBP-2)/SREBP cleavage-activated protein and reduces SREBP-2 cleavage.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17539022 2007 A constitutional balanced t(3;8)(p14;q24.1) translocation results in disruption of the TRC8 gene and predisposition to clear cell renal cell carcinoma.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17016439 2007 RING-dependent tumor suppression and G2/M arrest induced by the TRC8 hereditary kidney cancer gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12032852 2002 The TRC8 hereditary kidney cancer gene suppresses growth and functions with VHL in a common pathway.
10500182 1999 RING fingers mediate ubiquitin-conjugating enzyme (E2)-dependent ubiquitination.
9689122 1998 The hereditary renal cell carcinoma 3;8 translocation fuses FHIT to a patched-related gene, TRC8.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.