Property Summary

NCBI Gene PubMed Count 20
PubMed Score 16.97
PubTator Score 17.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
glioblastoma multiforme 1.800 1.0e-21
posterior fossa group A ependymoma 1.400 9.9e-10
cystic fibrosis 1.397 1.1e-05
atypical teratoid / rhabdoid tumor 1.400 9.5e-05
juvenile dermatomyositis 1.181 3.4e-13
tuberculosis 1.500 4.5e-07
pilocytic astrocytoma 1.600 4.9e-09
subependymal giant cell astrocytoma 3.082 1.2e-03
ulcerative colitis -1.400 1.4e-07
ovarian cancer 2.200 1.8e-04

Protein-protein Interaction (9)

Gene RIF (8)

PMID Text
26368817 Data showed that the presence of the RNF135 K115 variant in the genotype of patients with autism was statistically significant.
23950712 Riplet-mediated K63-linked polyubiquitination released RIG-I RD autorepression, which allowed the access of positive factors to the RIG-I protein.
20546612 Observational study of gene-disease association. (HuGE Navigator)
19484123 REUL is an E3 ubiquitin ligase of RIG-I and specifically stimulates RIG-I-mediated innate antiviral activity
19291764 RNF135 mutations are not present in patients with Sotos syndrome-like features.
19291764 Observational study of gene-disease association. (HuGE Navigator)
19017631 identify an alternative factor, Riplet/RNF135, that promotes RIG-I activation independent of TRIM25
17632510 These data identify RNF135 as causative of a new overgrowth syndrome and demonstrate that RNF135 haploinsufficiency contributes to the phenotype of NF1 microdeletion cases.

AA Sequence

MAGLGLGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARDARRWACPTCRQGAAQQP      1 - 70
HLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSSLSSAAARPRRRPELQRVAVEKSITEVAQELTE     71 - 140
LVEHLVDIVRSLQNQRPLSESGPDNELSILGKAFSSGVDLSMASPKLVTSDTAAGKIRDILHDLEEIQEK    141 - 210
LQESVTWKEAPEAQMQGELLEAPSSSSCPLPDQSHPALRRASRFAQWAIHPTFNLKSLSCSLEVSKDSRT    211 - 280
VTVSHRPQPYRWSCERFSTSQVLCSQALSSGKHYWEVDTRNCSHWAVGVASWEMSRDQVLGRTMDSCCVE    281 - 350
WKGTSQLSAWHMVKETVLGSDRPGVVGIWLNLEEGKLAFYSVDNQEKLLYECTISASSPLYPAFWLYGLH    351 - 420
PGNYLIIKQVKV                                                              421 - 432
//

Text Mined References (21)

PMID Year Title
26368817 2015 Mutation screening of the ubiquitin ligase gene RNF135 in French patients with autism.
25416956 2014 A proteome-scale map of the human interactome network.
23950712 2013 A distinct role of Riplet-mediated K63-Linked polyubiquitination of the RIG-I repressor domain in human antiviral innate immune responses.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
19881509 2009 PCBP2 mediates degradation of the adaptor MAVS via the HECT ubiquitin ligase AIP4.
19484123 2009 REUL is a novel E3 ubiquitin ligase and stimulator of retinoic-acid-inducible gene-I.
19291764 2009 RNF135 mutations are not present in patients with Sotos syndrome-like features.
19017631 2009 Riplet/RNF135, a RING finger protein, ubiquitinates RIG-I to promote interferon-beta induction during the early phase of viral infection.
18391951 2008 Many sequence variants affecting diversity of adult human height.
17632510 2007 Mutations in RNF135, a gene within the NF1 microdeletion region, cause phenotypic abnormalities including overgrowth.
17392790 2007 TRIM25 RING-finger E3 ubiquitin ligase is essential for RIG-I-mediated antiviral activity.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15334068 2004 Suppression subtractive hybridization and expression profiling identifies a unique set of genes overexpressed in non-small-cell lung cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12696059 2003 Complete physical map and gene content of the human NF1 tumor suppressor region in human and mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11468690 2001 Molecular characterization and gene content of breakpoint boundaries in patients with neurofibromatosis type 1 with 17q11.2 microdeletions.
11002417 2000 Activation of the NF-kappaB pathway by caspase 8 and its homologs.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.