Property Summary

NCBI Gene PubMed Count 10
PubMed Score 148.78
PubTator Score 5.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -3.300 2.1e-07
astrocytic glioma -1.700 1.8e-02
Astrocytoma, Pilocytic -2.500 1.3e-09
atypical teratoid / rhabdoid tumor -3.700 2.8e-07
Chronic Lymphocytic Leukemia 1.050 1.4e-02
Down syndrome 1.200 5.3e-04
ependymoma -2.400 2.2e-02
glioblastoma -2.600 1.2e-08
intraductal papillary-mucinous carcinoma... -1.200 1.6e-02
intraductal papillary-mucinous neoplasm ... -1.600 1.8e-03
medulloblastoma, large-cell -2.700 9.3e-06
oligodendroglioma -1.300 2.7e-09
osteosarcoma 1.639 2.4e-07
ovarian cancer -1.800 4.1e-07
pancreatic ductal adenocarcinoma liver m... -2.211 7.5e-04
Pick disease 1.100 2.2e-03
primitive neuroectodermal tumor -1.400 1.8e-02
spina bifida -1.757 4.3e-02
subependymal giant cell astrocytoma -3.271 2.1e-02

Gene RIF (3)

AA Sequence

MSCAGRAGPARLAALALLTCSLWPARADNASQEYYTALINVTVQEPGRGAPLTFRIDRGRYGLDSPKAEV      1 - 70
RGQVLAPLPLHGVADHLGCDPQTRFFVPPNIKQWIALLQRGNCTFKEKISRAAFHNAVAVVIYNNKSKEE     71 - 140
PVTMTHPGTGDIIAVMITELRGKDILSYLEKNISVQMTIAVGTRMPPKNFSRGSLVFVSISFIVLMIISS    141 - 210
AWLIFYFIQKIRYTNARDRNQRRLGDAAKKAISKLTTRTVKKGDKETDPDFDHCAVCIESYKQNDVVRIL    211 - 280
PCKHVFHKSCVDPWLSEHCTCPMCKLNILKALGIVPNLPCTDNVAFDMERLTRTQAVNRRSALGDLAGDN    281 - 350
SLGLEPLRTSGISPLPQDGELTPRTGEINIAVTKEWFIIASFGLLSALTLCYMIIRATASLNANEVEWF     351 - 419
//

Text Mined References (13)

PMID Year Title