Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.63
PubTator Score 10.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
osteosarcoma -2.338 3.2e-03
non-small cell lung cancer -1.480 1.7e-16
intraductal papillary-mucinous adenoma (... 1.100 4.7e-02
lung cancer -1.700 4.9e-03
Breast cancer -2.400 4.9e-02
group 4 medulloblastoma -1.100 9.9e-03
pilocytic astrocytoma 1.400 2.7e-03
primary Sjogren syndrome 1.200 1.0e-03
ductal carcinoma in situ -1.100 6.0e-03
invasive ductal carcinoma -1.300 2.9e-02
ulcerative colitis -1.500 1.8e-04
ovarian cancer -1.500 2.3e-05
cystic fibrosis and chronic rhinosinusit... 1.132 3.6e-03

Gene RIF (9)

PMID Text
26202983 Results indicate that the nucleotide sequence in the 3' untranslated region (3' UTR) of ring finger protein 125 (RNF125) is a potential microRNA miR-15b targeting site.
26027934 we identified the downregulation of the ubiquitin ligase RNF125 in BRAFi-resistant melanomas
25196541 studies of the RNF125 pathway point to upregulation of RIG-I-IPS1-MDA5 and/or disruption of the PI3K-AKT and interferon signaling pathways as the putative final effectors
24131985 In controls, RNF125 is the highest expressed gene, whereas in HIV infection progressors, RIG-I is either the highest expressed gene or is expressed similarly to RNF125 and TRIM25.
23772026 study reports human bocavirus VP2 modulates IFN pathway by targeting the ring finger protein 125, a negative regulator of type I IFN signaling, which conjugates Lys(48)-linked ubiquitination to retinoic acid-inducible gene-I and leads to the proteasome-dependent degradation of RIG-I
22632162 HIV-1 Tat 47-59 peptide upregulates gene expression of ring finger protein 125, E3 ubiquitin protein ligase (RNF125) in U-937 macrophages
17990982 TRAC-1 associates with membranes and is excluded from the nucleus through myristoylation
17643463 These results suggest that RNF125/TRAC-1 could function to recruit host factor(s) controlling HIV-1 transcription to the ubiquitin-proteasome pathway.
17643463 HIV-1 Tat 47-59 peptide upregulates gene expression of ring finger protein 125, E3 ubiquitin protein ligase (RNF125) in U-937 macrophages

AA Sequence

MGSVLSTDSGKSAPASATARALERRRDPELPVTSFDCAVCLEVLHQPVRTRCGHVFCRSCIATSLKNNKW      1 - 70
TCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQKYIDKYGPLQELEETAARCV     71 - 140
CPFCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIE    141 - 210
EALIRRVLDRSLLEYVNHSNTT                                                    211 - 232
//

Text Mined References (14)

PMID Year Title
26202983 2015 MicroRNA-15b Modulates Japanese Encephalitis Virus-Mediated Inflammation via Targeting RNF125.
26027934 2015 Downregulation of the Ubiquitin Ligase RNF125 Underlies Resistance of Melanoma Cells to BRAF Inhibitors via JAK1 Deregulation.
25196541 2014 A new overgrowth syndrome is due to mutations in RNF125.
24131985 2013 Expression levels of the innate response gene RIG-I and its regulators RNF125 and TRIM25 in HIV-1-infected adult and pediatric individuals.
23772026 2013 Human bocavirus VP2 upregulates IFN-? pathway by inhibiting ring finger protein 125-mediated ubiquitination of retinoic acid-inducible gene-I.
17990982 2008 T-cell regulator RNF125/TRAC-1 belongs to a novel family of ubiquitin ligases with zinc fingers and a ubiquitin-binding domain.
17643463 2007 The RING finger ubiquitin ligase RNF125/TRAC-1 down-modulates HIV-1 replication in primary human peripheral blood mononuclear cells.
15843525 2005 A novel E3 ubiquitin ligase TRAC-1 positively regulates T cell activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12974981 2003 Systematic identification of regulatory proteins critical for T-cell activation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8744354 1996 Does this have a familiar RING?
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.