Property Summary

NCBI Gene PubMed Count 23
PubMed Score 11.61
PubTator Score 13.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Inflammatory dermatosis 38
Disease Target Count P-value
glioblastoma 5572 1.5e-05
ovarian cancer 8491 1.8e-05
osteosarcoma 7933 7.3e-05
dermatomyositis 966 3.2e-03
breast carcinoma 1614 7.9e-03
Multiple myeloma 1327 9.7e-03
Disease Target Count Z-score Confidence
psoriasis 6685 4.555 2.3
Disease Target Count Z-score Confidence
Psoriatic arthritis 85 3.085 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.344 9.7e-03
osteosarcoma -1.500 7.3e-05
glioblastoma 1.300 1.5e-05
breast carcinoma 1.300 7.9e-03
ovarian cancer 1.700 1.8e-05
dermatomyositis 1.700 3.2e-03

Gene RIF (11)

PMID Text
25313037 XAF1 stimulates HIPK2-mediated Ser-46 phosphorylation of p53 and XAF1 also steps up the termination of p53-mediated cell-cycle arrest by activating ZNF313.
25165885 RNF114 is a new partner of A2O involved in the regulation of NF-kappaB activity that contributes to the control of signaling pathways modulating T cell-mediated immune response.
24631332 RNF114 over-expression had a promotion effect on T cell activation with an average 43.97% increment and the upregulatory roles showed a dose-dependent effect with 18.44% increment.
23645206 ZNF313 is a novel cell cycle activator with an E3 ligase activity inhibiting cellular senescence by destabilizing p21(WAF1.).
23617596 A single nucleotide plymorphism had an association with psoriasis in this Chinese Uygur population: SNP rs495337 in the gene encoding for zinc finger protein 313 (P < 0.001; OR = 0.80)
22205304 Rare disease-associated variants in the promoter region of the RNF114 psoriasis susceptibility gene have been identified.
21571784 RNF114 regulates a positive feedback loop that enhances double-stranded RNA induced production of type I interferon.
20953189 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20515446 ZNF313 is controlled at the transcriptional level, and a common mechanism controlling the basal transcription of ZNF313 gene exists.
18364390 ZNF313 is a novel psoriasis susceptibility gene.
18364390 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAQQRDCGGAAQLAGPAAEADPLGRFTCPVCLEVYEKPVQVPCGHVFCSACLQECLKPKKPVCGVCRSA      1 - 70
LAPGVRAVELERQIESTETSCHGCRKNFFLSKIRSHVATCSKYQNYIMEGVKATIKDASLQPRNVPNRYT     71 - 140
FPCPYCPEKNFDQEGLVEHCKLFHSTDTKSVVCPICASMPWGDPNYRSANFREHIQRRHRFSYDTFVDYD    141 - 210
VDEEDMMNQVLQRSIIDQ                                                        211 - 228
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25313037 2014 XAF1 directs apoptotic switch of p53 signaling through activation of HIPK2 and ZNF313.
25165885 2014 The RING ubiquitin E3 RNF114 interacts with A20 and modulates NF-?B activity and T-cell activation.
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
24631332 2014 Identification of RNF114 as a novel positive regulatory protein for T cell activation.
23645206 2013 ZNF313 is a novel cell cycle activator with an E3 ligase activity inhibiting cellular senescence by destabilizing p21(WAF1.).
23617596 2013 Genetic variants of the genes encoding zinc finger protein 313 and interleukin-13 confer a risk for psoriasis in a Chinese Uygur population.
22205304 2012 Identification of rare, disease-associated variants in the promoter region of the RNF114 psoriasis susceptibility gene.
21571784 2011 Functional analysis of the RNF114 psoriasis susceptibility gene implicates innate immune responses to double-stranded RNA in disease pathogenesis.
21269460 2011 Initial characterization of the human central proteome.
20953190 2010 A genome-wide association study identifies new psoriasis susceptibility loci and an interaction between HLA-C and ERAP1.
20953189 2010 Genome-wide association analysis identifies three psoriasis susceptibility loci.
20515446 2010 Sp1 plays an important role in regulating the transcription of ZNF313.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
18364390 2008 Identification of ZNF313/RNF114 as a novel psoriasis susceptibility gene.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12621547 2003 Identification of a novel human zinc finger protein gene ZNF313.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.