Property Summary

NCBI Gene PubMed Count 13
PubMed Score 35.55
PubTator Score 27.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer -1.800 6.1e-31
hepatocellular carcinoma -1.900 1.0e-03
intraductal papillary-mucinous adenoma (... 1.400 2.3e-04
malignant mesothelioma -1.300 1.5e-06
ovarian cancer -1.900 1.9e-08
Rheumatoid arthritis 1.400 1.1e-02
subependymal giant cell astrocytoma -1.350 2.4e-02
tuberculosis 1.200 2.0e-03

Gene RIF (2)

AA Sequence

MWLKLFFLLLYFLVLFVLARFFEAIVWYETGIFATQLVDPVALSFKKLKTILECRGLGYSGLPEKKDVRE      1 - 70
LVEKSGDLMEGELYSALKEEEASESVSSTNFSGEMHFYELVEDTKDGIWLVQVIANDRSPLVGKIHWEKM     71 - 140
VKKVSRFGIRTGTFNCSSDPRYCRRRGWVRSTLIMSVPQTSTSKGKVMLKEYSGRKIEVEHIFKWITAHA    141 - 210
ASRIKTIYNAEHLKEEWNKSDQYWLKIYLFANLDQPPAFFSALSIKFTGRVEFIFVNVENWDNKSYMTDI    211 - 280
GIYNMPSYILRTPEGIYRYGNHTGEFISLQAMDSFLRSLQPEVNDLFVLSLVLVNLMAWMDLFITQGATI    281 - 350
KRFVVLISTLGTYNSLLIISWLPVLGFLQLPYLDSFYEYSLKLLRYSNTTTLASWVRADWMFYSSHPALF    351 - 420
LSTYLGHGLLIDYFEKKRRRNNNNDEVNANNLEWLSSLWDWYTSYLFHPIASFQNFPVESDWDEDPDLFL    421 - 490
ERLAFPDLWLHPLIPTDYIKNLPMWRFKCLGVQSEEEMSEGSQDTENDSESENTDTLSSEKEVFEDKQSV    491 - 560
LHNSPGTASHCDAEACSCANKYCQTSPCERKGRSYGSYNTNEDMEPDWLTWPADMLHCTECVVCLENFEN    561 - 630
GCLLMGLPCGHVFHQNCIVMWLAGGRHCCPVCRWPSYKKKQPYAQHQPLSNDVPS                   631 - 685
//

Text Mined References (13)

PMID Year Title