Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.31
PubTator Score 6.42

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 2.6e-07
osteosarcoma 7933 3.6e-06
psoriasis 6685 3.2e-05
lung cancer 4473 2.3e-04
spina bifida 1064 4.2e-02


  Differential Expression (5)

Disease log2 FC p
psoriasis -1.700 3.2e-05
osteosarcoma -3.528 3.6e-06
lung cancer -1.200 2.3e-04
spina bifida -1.083 4.2e-02
ovarian cancer 1.400 2.6e-07

Pathway (1)

Gene RIF (4)

24151200 CYB5A, which has a role in stearyl-CoA-desaturase activity, and RNF10, with an unknown role in weight regulating pathways, associated with adiposity and nominally increased the risk for T2D in American Indians.
18941509 RNF10 is a trans-acting protein regulating MAG expression and is required for myelin formation.
18854154 Knockdown of ring finger protein 10 (RNF10) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
16335786 MEOX2 and Meox2 binding to RNF10 protein was characterized.

AA Sequence

AAFMKLDTPATSDPLSEEKGGKKRKKQKQKLLFSTSVVHTK                                 771 - 811

Text Mined References (16)

PMID Year Title
24151200 2014 Whole exome sequencing identifies variation in CYB5A and RNF10 associated with adiposity and type 2 diabetes.
24105792 2014 Protein microarray characterization of the S-nitrosoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23028342 2012 New susceptibility loci associated with kidney disease in type 1 diabetes.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
18941509 2008 A novel function of RING finger protein 10 in transcriptional regulation of the myelin-associated glycoprotein gene and myelin formation in Schwann cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16335786 2005 Characterization of Mesenchyme Homeobox 2 (MEOX2) transcription factor binding to RING finger protein 10.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
10697961 2000 cDNA cloning, expression profile, and genomic structure of human and mouse RNF10/Rnf 10 genes, encoding a novel RING finger protein.
9039502 1996 Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.